Recombinant Mouse Heme oxygenase 1(Hmox1)

Code CSB-YP010583MO
Size US$1593
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP010583MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Hmox1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP010583MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Hmox1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Hmox1
Uniprot No. P14901
Research Area Others
Alternative Names Hmox1; Heme oxygenase 1; HO-1; EC 1.14.14.18; P32 protein
Species Mus musculus (Mouse)
Source Yeast
Expression Region 1-289aa
Target Protein Sequence MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 34.9kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Gene References into Functions
  1. Mice lacking Hmox1 exhibited a significant increase in concentrations of liver and brain gangliosides and in mRNA expression of the key enzymes of ganglioside metabolism PMID: 30327713
  2. Ori might exhibit a protective role against H2O2-stimulated oxidative damage by the induction of HO-1 expression through the activation of the JNK- and PI3K/AKT-Nrf2 signaling pathways. PMID: 29959995
  3. This is the first study to demonstrate the regulatory role of HO-1 in silicosis. PMID: 30068325
  4. The HO-1-mediated pathway is involved in the suppressive effects of FNDC4 on inflammation and insulin resistance. PMID: 29787756
  5. HO-1 enhanced STAT3 phosphorylation, which enriched to Il12b and Il23a loci and negatively regulated their transcription. These findings demonstrate the underlying mechanism through which a nutritional can interfere with the immune response. CUR silences IL-23/Th17-mediated pathology by enhancing HO-1/STAT3 interaction in dendritic cells. PMID: 28290522
  6. HO-1 reduces HFD-induced AKT2 phosphorylation via ROS thresholding in mitochondria to reduce visceral adipose precursor proliferation. HO-1 influences adipogenesis in a cell-autonomous way by regulating events early in adipogenesis, during the process of mitotic clonal expansion, upstream of Cebpalpha and PPARgamma. PMID: 28102348
  7. Involved in the Nrf2/HO-1 pathway. PMID: 29730008
  8. Studied effect of Sargassum horneri (Turner) C. Agardh ethanol extract (SHE) on inflammation induced by fine dust in RAW 264.7 cells. Results suggest SHE protects the cells from oxidative stress in part by activating the nuclear factor erythroid derived 2 like 2 /heme oxygenase 1 (Nrf2/HO-1) signal pathway. PMID: 30200963
  9. Our results reveal a previously unrecognized function of HO-1 in regulating SMC gene expressions during ESC-EB development. PMID: 29216542
  10. HO-1 protects bone marrow mesenchymal stem cells from reactive oxygen species by secreting IL-10 upon iron overload. PMID: 29111167
  11. Results show that renal myeloid cells upregulate HO-1 upon renal ischemia-reperfusion injury (IRI). Also, myeloid HO-1 mitigates both innate immune responses and oxidative stress upon renal IRI. PMID: 28298633
  12. Findings demonstrate that myeloid HO-1 plays an anti-inflammatory role in the acute response to zymosan in vivo. PMID: 29599896
  13. Genetic Hmox1 partial deficiency is sufficient to sensitize mice to the development of diabetic glomerular microvascular lesions. HO-1 exerts antioxidant effects in the kidney during diabetes mellitus. These have protective effects on the development of glomerular endothelial injury. PMID: 29359167
  14. Inhibition of miR-92a attenuates oxidative stress and improves endothelial function through enhancing HO-1 expression and activity in db/db mouse aortas PMID: 28683566
  15. n-propargyl caffeamide (PACA) attenuated LPS-induced NF-kB activation while activated Nrf2/HO-1 pathway. HO-1 inhibitor SnPP attenuated the effects of PACA on iNOS expression in LPS-challenged macrophages, possibly by regulating the cross-talk between HO-1 and NF-kB pathways. PMID: 29996121
  16. Ablation of adipose tissue-HO-1 abridged PGC1 expression promoted mitochondrial dysfunction and contributed to an increase of pro-inflammatory visceral fat and abrogated beige-cell like phenotype. PMID: 28763300
  17. These results suggested that schisandrin A has a protective effect against LPS-induced inflammatory and oxidative responses in RAW 264.7 cells by inhibiting the NF-kappaB, MAPK and PI3K/Akt pathways; these effects are mediated, at least in part, by the activation of the Nrf2/HO-1 pathway PMID: 29115385
  18. Newborns appear to be protected from the pro-oxidative effects of free heme (FH), which may be mediated by heme binding and a higher absolute HO activity at baseline and after FH-mediated induction. PMID: 28926834
  19. Rosiglitazone Regulates TLR4 and Rescues HO-1 and NRF2 Expression in Myometrial and Decidual Macrophages in Inflammation-Induced Preterm Birth. PMID: 28322133
  20. this study shows that induction of heme oxygenas-1 attenuates NLRP3 inflammasome activation in lipopolysaccharide-induced mastitis in mice PMID: 28938188
  21. DADLE was able to significantly improve hepatic I/R injury in mice, and the specific mechanism may be associated with the Nrf2/HO1 signaling pathway. PMID: 28901476
  22. HO-1 role in the feedback response to blood carbon monoxide depletion PMID: 27057920
  23. Pretreatment with Zinc L-carnosine was able to activate Nrf2/HO-1 signaling pathway, thus suppressing the expression of inflammatory mediators, such as NO and iNOS in LPS-induced RAW 264.7 cells. PMID: 28697633
  24. Study demonstrated that a higher level of HO-1 associated with higher levels of injury severity, histological lesions and behavioral deficits in males than in females was induced by striatal ferrous citrate-infusion, which simulates iron overload in the striatum after intracerebral hemorrhage. PMID: 27198537
  25. these results indicate that MaR 1 protects against lung I/R injury through suppressing oxidative stress. The mechanism is partially explained by activation of the Nrf-2-mediated HO-1 signaling pathway. PMID: 28751936
  26. Splenic Ly6C(hi) monocytes contribute to adverse late post-ischemic left ventricular remodeling in heme oxygenase-1 deficient mice. PMID: 28534119
  27. findings suggest that HO-1 protects against I/R-induced hepatic injury via regulation of mitochondrial QC by PGAM5 signaling. PMID: 29524517
  28. this study shows that heme oxygenase 1 affects granulopoiesis in mice through control of myelocyte proliferation PMID: 28576353
  29. HO-1(pos) /CD169(neg) macrophages in jejunal serosa and at Auerbach's plexus up-regulated by lipopolysaccharide PMID: 27860408
  30. The results demonstrated that restoration of Brg1 during reperfusion could enhance Nrf2-mediated inducible expression of HO-1 during hepatic ischemia-reperfusion injury to effectively increase antioxidant ability to combat against hepatocytes damage. PMID: 28569786
  31. report that TLR signaling involving MyoD88 has a negative role in egress of HSPCs from BM into PB as TLR signaling enhances expression of HO-1 in hematopoietic cells PMID: 27560112
  32. Taken together, these findings suggest that 2,3,5,4'-Tetrahydroxystilbene-2-O-beta-D-glucoside (TSG) enhances mitochondrial biogenesis and function mainly via activation the HO-1. TSG can be developed as a potential drug for treatment of inflammatory diseases. PMID: 28473878
  33. The in vitro study illustrated that the anti-inflammatory effects of RA-XII were partially reversed following Nrf2 and HO-1 inhibition. Together, these findings strongly suggested that RA-XII is a potential agent against acute kidney injury. PMID: 29277609
  34. mRNA and protein levels of heme oxygenase-1 (HO-1)aresignificantly increased by Melaleuca alternifolia oil via p38 and JNK MAPK activation. PMID: 29121804
  35. Together with results showing involvement of TTF-1 in the TNF-alpha-induced increase in interleukin 1 beta and monocyte chemotactic protein 1 production, this study suggests that TTF-1 plays an important role in the mouse hypothalamus TNF-alpha-induced inflammatory response for regulating HO-1 gene expression. PMID: 29305861
  36. Curtailment of glial HO-1 transduction at strategic points of the life course may confer neuroprotection in human degenerative and developmental central nervous system disorders. PMID: 28746897
  37. Results indicate the essential roles of heme oxygenase-1 (HO-1) in suppressing the pathogenesis of abdominal aortic aneurysm (AAA), suggesting targeting HO-1 might be a promising therapeutic strategy for AAA. PMID: 27626316
  38. inadequate HO-1 in striatal astrocytes might contribute to the limited antioxidant defense and dopaminergic neuron degeneration in PD, and preferential HO-1 activation in striatal astrocytes might be neuroprotective. PMID: 26385576
  39. results indicate that high expression of HO-1 may reduce the severity of acute graft-versus-host disease by regulation of the TH17/Treg balance PMID: 27168057
  40. YZH-106 induced p38 MAPK and ERK1/2 phosphorylation, which led to the activation of erythroid 2-related factor 2 (Nrf2) that up-regulated heme oxygenase-1 (HO-1) expression in addition to other genes. PMID: 27107768
  41. our data indicate that luteolin diminishes the proinflammatory mediators NO, inflammatory cytokines and the expression of their regulatory genes, iNOS and COX-2, in PRV-infected RAW264.7 cells by inhibiting STAT1/3 dependent NF-kappaB activation and inducing Nrf2mediated HO-1 expression. PMID: 27016074
  42. we demonstrate that RG induces HO-1 expression by promoting phosphorylation of Nrf2 at Ser40 through activation of the ERK1/2 and JNK cascade in macrophages. PMID: 28257879
  43. We conclude that 1) CIH induces expression of HO-1 in the C1 and pre-BotC regions within 1 day and 2) HO-1 is necessary for hypoxia respiratory response and contributes to the maintenance of the hypoxic sigh responses and baseline sympathetic activity during CIH. PMID: 27609199
  44. this study demonstrates that ammonia stimulates the expression of HO-1 in endothelial cells via the ROS-Nrf2 pathway, and that the induction of HO-1 contributes to the cytoprotective action of ammonia by generating carbon monoxide. Moreover, it identifies ammonia as a potentially important signaling gas in the vasculature that promotes endothelial cell survival. PMID: 27867098
  45. HO-1 influences granulopoiesis through regulation of myelocyte proliferation. It is accompanied by changes in expression of transcriptionally active C/EBPbeta protein. PMID: 27817989
  46. EET-mediated increase in HO-1 levels require PGC-1alpha expression PMID: 27418542
  47. Downregulation of inducible NO synthetase (iNOS) resulted in downregulation of heme oxygenase 1 (HO-1), and, conversely, upregulation of iNOS enhanced HO-1 activity. PMID: 27752990
  48. Data suggest the a decrease in migration of hematopoietic stem progenitor cells (HSPCs) can be explained by impaired calcium release in phospholipase C-beta2 (PLC-beta2) knockout (KO) mice and a high baseline level of heme oxygenase 1 (HO-1), an enzyme that negatively regulates cell migration. PMID: 27704316
  49. HO-1 expression is upregulated by hydrogen-rich water in a mouse model of in fl ammatory bowel disease, which also inhibits inflammatory factors, and oxidative stress and ER stress PMID: 28293084
  50. study demonstrates that human respiratory syncytial virus (hRSV) infection can be modulated by the expression of HO-1 both in vitro and in vivo; thus, HO-1 activity may play a critical role during hRSV infection PMID: 28566367
  51. This is the first study to dissect the mechanism by which the antiadipogenic and anti-inflammatory lipid, Epoxyeicosatrienoic acid, induces the PGC-1alpha signaling cascade and reprograms the adipocyte phenotype by regulating mitochondrial function and HO-1 expression. PMID: 27224420
  52. The findings suggest that HO-1 by modulating TLR9 expression in PMCs promotes pleural innate immunity in MRSA empyema. PMID: 28052108
  53. HO-1 regulates not only cytokine/chemokine production in pregnant uteri but also myeloid cell receptor numbers. PMID: 27468759
  54. Administration of EET alters Wnt1, NOV, and HO-1 signaling to prevent obesity-induced cardiomyopathy in obese mice. PMID: 28576832
  55. Studied the immunosuppressive role of HO-1 in sepsis with a focus on its effects on helper T-cell (Th) differentiation and regulatory T cells; found overexpressed HO-1 contributes to sepsis-induced immunosuppression by inducing a Th1 to Th2 cytokine shift and enhancing Treg function. PMID: 28368519
  56. Data indicate that chlorogenic acid (CGA) protected osteoblast MC3T3-E1 cells against oxidative damage via PI3K/Akt-mediated activation of Nrf2/HO-1 pathway, which may be an effective drug in treatment of osteoporosis. PMID: 28122344
  57. our data suggest that the B. pseudomallei-mediated induction of HO-1 and the release of its metabolite carbon dixode impair bacterial clearance in macrophages and during murine melioidosis. PMID: 27316684
  58. HO-1 activation mediates early brain damage after ICH (intracerebral hemorrhage) but promotes neurologic function recovery in the later stage of ICH PMID: 27317654
  59. Heme Oxygenase 1 is associated with lung protection in malaria-associated acute lung injury/acute respiratory distress syndrome PMID: 27974865
  60. Irisin improved endothelial function by modulating HO-1/ adiponectin axis in perivascular adipose tissue (PVAT) in HFD-induced obese mice. These findings suggest that regulating PVAT function may be a potential mechanism by which irisin improves endothelial function in obesity. PMID: 28595178
  61. the role of HO-1-expressing DCs in tolerance induction PMID: 28033400
  62. A significant increase was found in Nrf2-ARE activity after partial hepatectomy (PHx). The signal maximum was recorded on the third day after PHx. Significantly more hepatocytes were positive for Nrf2 and HO-1 on the third postoperative day compared with baseline levels. The mRNA expression of HO-1 and NQO1 were significantly increased on day 3. PMID: 27884351
  63. our data show that Substance P (SP) treatment might be associated with anti-inflammatory effects in LPS-stimulated RAW 264.7 cells by suppressing NF-kappaB (p65)activation and inducing HO-1 expression. PMID: 27907187
  64. this study shows that the protective mechanisms of zerumbone on lipopolysaccharide-induced acute lung injury are via up-regulation of antioxidative enzymes and Nrf2/HO-1 pathway PMID: 28315822
  65. this study shows that enhanced levels of plasma heme, induced by either exogenous heme administration or a lack of HO-1 expression in macrophages, resulted in an increased susceptibility to sepsis via disruption of phagocyte functions PMID: 27798618
  66. Our result provides the direct evidence that HO-1 plays an important protective role in liver carcinogenesis. Alternatively, we suggest the possible explanation on effect of HO-1 promoter polymorphism which involved in tumorigenesis. PMID: 27810363
  67. this study shows that that sclareol inhibits acute lung edema, by affecting HO-1 signaling PMID: 28068646
  68. Angiotensinogen-mediated downregulation of aquaporin 1 and Nrf2 signalling may play an important role in intrarenal renin-angiotensin system-induced hypertension and kidney injury. PMID: 27638854
  69. loss of HO-1 in adipocytes has greater effects on body fat and fasting hyperglycemia in a sex-dependent fashion and that expression of HO-1 in adipose tissue may have a greater protective role in females as compared to males. PMID: 28287466
  70. Oleanolic acid can attenuate hepatic ischemia reperfusion injury via HO-1/Sesn2 signaling pathway. PMID: 27733322
  71. The results indicate that MHE exerts anti-inflammatory effects by suppressing inflammatory mediator production via NF-kappaB and MAPK signaling pathways inhibition and induction of HO-1 expression in macrophages. Therefore, our results suggest the potential value of MHE as an inflammatory therapeutic agent developed from a natural substance. PMID: 27338335
  72. HO-1/Carbon Monoxide can act as an antiresorption agent and reduce bone loss by blocking osteoclast differentiation. PMID: 28088947
  73. that miR-93 antagomir alleviates ischemic injury through the nuclear factor erythroid 2-related factor (Nrf2) and heme oxygenase-1 (HO-1) antioxidant pathway PMID: 27300700
  74. Antioxidant, S-propyl-cysteine protects against NAFLD via PI3K/Akt/Nrf2/HO-1 signaling pathway. PMID: 27313828
  75. HO-1 is an inhibitor of hematopoietic cell migration in response to crucial bone marrow homing chemoattractants. PMID: 27412411
  76. Data indicate that heme oxygenase-1 (HO-1)-mediated downregulation of NF-kappa B p65 was involved in the anti-psoriatic effect of Terminalia chebulanin (TC). PMID: 27383847
  77. Gwakhyangjeonggisan enhanced expression of heme oxygenase1 and prevented the generation of reactive oxygen species in RAW 264.7 cells. PMID: 27052497
  78. HO-1 was upregulated in spinal cord microglial cells after spinal nerve injury. PMID: 26361083
  79. tussilagonone exerts its anti-inflammatory effects via upregulation of HO-1 expression PMID: 26950613
  80. Demonstrate role for heme oxygenase 1 inhibitor zinc protoporphyrin in the treatment of neonatal hyperbilirubinemia caused by hemolytic diseases. PMID: 26488552
  81. Our results suggest a protective function of HO-1 induction in psoriasis. The protective effect of HO-1 may be attributed to its effect on the Stat3 signaling pathway via increased SHP-1 expression. PMID: 26893174
  82. Our findings establish the HO-1/CO system and redox regulation of mitochondrial biogenesis as essential factors in ES cell differentiation as well as in the subsequent maturation of these cells into functional cardiac cells. PMID: 26725491
  83. LPS-stimulated TNF-alpha was significantly decreased, whereas IRG1 and A20 were increased by CORM-2 application and HO-1 induction, which in turn were abrogated by ZnPP. PMID: 25640654
  84. 4,7-Dimethoxy-5-methyl-1,3-benzodioxole from Antrodia camphorata increased hemoxygenase-1 expression in macrophages PMID: 26745712
  85. These results suggest that RvD1 could effectively prevent CCl4-induced liver injury by inhibition of oxidative stress and inflammation, and the underlying mechanism may be related to up-regulation of HO-1. PMID: 26630551
  86. Our findings demonstrate that DEE and a fraction derived from this extract exerts anti-inflammatory effects through Nrf2dependent HO-1 expression PMID: 26647788
  87. Tissue HO-1 exerts anti-inflammatory effects on lipopolysaccharide-induced pulmonary inflammation. PMID: 25943274
  88. Data suggest that HO-1-derived CO from tumor-associated macrophages influences, in part, E-cadherin expression and thus tumor initiation and progression. PMID: 26418896
  89. Irradiation inhibits osteoblast differentiation and mineralization of MC3T3-E1 cells through the oxidative stress-mediated activation of Nrf2/HO-1 pathway. PMID: 26346162
  90. HO-1 is an essential enzyme for iron-dependent lipid peroxidation during ferroptotic cell death PMID: 26405158
  91. Data indicate that a reduced expression of heme oxygenase 1 (HO-1) was observed in sciatic nerves of diabetic mice treated with cobalt protoporphyrin IX (CoPP). PMID: 26730587
  92. we provide evidence of a crucial role of HO-1 in limiting aneurysm growth by showing that HO-1 induction by heme slows AAA progression. PMID: 26894432
  93. curcumin promotes the acquisition of an alternative microglial phenotype in an HO-1-dependent manner and reduces iNOS induction and ROS production PMID: 26047311
  94. our findings demonstrated that HO-1 exerted its anti-inflammatory function through suppression of basophil maturation and activation, but promotion of basophil apoptosis PMID: 26879758
  95. HO-1 induces a paracrine signalling in macrophages via reactive oxygen species production, mediating apoptosis of heart muscle cells at later stages of myocarditis. PMID: 24401606
  96. Collectively, these results demonstrate that isorhamnetin augments the cellular antioxidant defense capacity by activating the Nrf2/HO-1 pathway involving the activation of the ERK pathway, thus protecting the C2C12 cells from H2O2-induced cytotoxicity. PMID: 26830132
  97. that HO-1 prevents renal tubulointerstitial fibrosis possibly by regulating the inflammatory response and Wnt/beta-catenin signaling. PMID: 26765329
  98. Amomum tsao-ko fruit extract suppresses lipopolysaccharide-induced inducible nitric oxide synthase by inducing heme oxygenase-1 in macrophages and in septic mice. PMID: 26852687
  99. HO-1 emerges as a novel immune regulator in neuroblastoma PMID: 26595750
  100. In an attempt to unveil mechanism(s) for quercetin to enhance Nrf2/HO-1 activity under endotoxic stress, results pointed to an increase in phospho-p38MAPK expression upon addition of quercetin to LPS PMID: 26505893

Show More

Hide All

Subcellular Location Microsome, Endoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families Heme oxygenase family
Database Links

KEGG: mmu:15368

STRING: 10090.ENSMUSP00000005548

UniGene: Mm.276389

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1