Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Hmox1; Heme oxygenase 1; HO-1; EC 1.14.14.18; P32 protein
Species
Mus musculus (Mouse)
Expression Region
1-289aa
Target Protein Sequence
MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression vector recombined with the recombinant DNA was transfected into the yeast cells for expression. The recombinant DNA resulted from the fusion of the gene coding for the 1-289aa of the mouse Hmox1 protein and the N-terminal 6xHis tag gene. The product was purified and isolated to get the recombinant mouse Hmox1 protein with N-terminal 6xHis tag. The purity of this recombinant Hmox1 protein reaches up to 90%. Under SDS-PAGE condition, this recombinant Hmox1 protein showed a band with a molecular weight of about 32 kDa on the gel.
Hmox1 is a gene encoded a protein named Hmox1 in mouse. This protein belongs Heme oxygenase family. Mice lacking Hmox1 exhibited a significant increase in concentrations of liver and brain gangliosides and in mRNA expression of the key enzymes of ganglioside metabolism. This gene in human is named HMOX1 (heme oxygenase 1 gene) encoding an enzyme called heme oxygenase 1 (abbreviated HMOX1 or HO-1). The protein mediates the first step of heme catabolism, it cleaves heme to form biliverdin. Recently, a study reported that high dose expression of heme oxigenase-1 induces retinal degeneration through ER stress-related DDIT3. This study revealed that HMOX1 plays a dual role in retinal degeneration, and clarified the pathogenic mechanism of high-dose HMOX1 inducing photoreceptor cell degeneration through the endoplasmic reticulum stress effector DDIT3.