Recombinant Mouse Heme oxygenase 1 (Hmox1)

Code CSB-EP010583MO
Abbreviation Recombinant Mouse Hmox1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Hmox1; Heme oxygenase 1; HO-1; EC 1.14.14.18; P32 protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-289aa
Target Protein Sequence
MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Gene References into Functions
  1. Mice lacking Hmox1 exhibited a significant increase in concentrations of liver and brain gangliosides and in mRNA expression of the key enzymes of ganglioside metabolism PMID: 30327713
  2. Ori might exhibit a protective role against H2O2-stimulated oxidative damage by the induction of HO-1 expression through the activation of the JNK- and PI3K/AKT-Nrf2 signaling pathways. PMID: 29959995
  3. This is the first study to demonstrate the regulatory role of HO-1 in silicosis. PMID: 30068325
  4. The HO-1-mediated pathway is involved in the suppressive effects of FNDC4 on inflammation and insulin resistance. PMID: 29787756
  5. HO-1 enhanced STAT3 phosphorylation, which enriched to Il12b and Il23a loci and negatively regulated their transcription. These findings demonstrate the underlying mechanism through which a nutritional can interfere with the immune response. CUR silences IL-23/Th17-mediated pathology by enhancing HO-1/STAT3 interaction in dendritic cells. PMID: 28290522
  6. HO-1 reduces HFD-induced AKT2 phosphorylation via ROS thresholding in mitochondria to reduce visceral adipose precursor proliferation. HO-1 influences adipogenesis in a cell-autonomous way by regulating events early in adipogenesis, during the process of mitotic clonal expansion, upstream of Cebpalpha and PPARgamma. PMID: 28102348
  7. Involved in the Nrf2/HO-1 pathway. PMID: 29730008
  8. Studied effect of Sargassum horneri (Turner) C. Agardh ethanol extract (SHE) on inflammation induced by fine dust in RAW 264.7 cells. Results suggest SHE protects the cells from oxidative stress in part by activating the nuclear factor erythroid derived 2 like 2 /heme oxygenase 1 (Nrf2/HO-1) signal pathway. PMID: 30200963
  9. Our results reveal a previously unrecognized function of HO-1 in regulating SMC gene expressions during ESC-EB development. PMID: 29216542
  10. HO-1 protects bone marrow mesenchymal stem cells from reactive oxygen species by secreting IL-10 upon iron overload. PMID: 29111167
  11. Results show that renal myeloid cells upregulate HO-1 upon renal ischemia-reperfusion injury (IRI). Also, myeloid HO-1 mitigates both innate immune responses and oxidative stress upon renal IRI. PMID: 28298633
  12. Findings demonstrate that myeloid HO-1 plays an anti-inflammatory role in the acute response to zymosan in vivo. PMID: 29599896
  13. Genetic Hmox1 partial deficiency is sufficient to sensitize mice to the development of diabetic glomerular microvascular lesions. HO-1 exerts antioxidant effects in the kidney during diabetes mellitus. These have protective effects on the development of glomerular endothelial injury. PMID: 29359167
  14. Inhibition of miR-92a attenuates oxidative stress and improves endothelial function through enhancing HO-1 expression and activity in db/db mouse aortas PMID: 28683566
  15. n-propargyl caffeamide (PACA) attenuated LPS-induced NF-kB activation while activated Nrf2/HO-1 pathway. HO-1 inhibitor SnPP attenuated the effects of PACA on iNOS expression in LPS-challenged macrophages, possibly by regulating the cross-talk between HO-1 and NF-kB pathways. PMID: 29996121
  16. Ablation of adipose tissue-HO-1 abridged PGC1 expression promoted mitochondrial dysfunction and contributed to an increase of pro-inflammatory visceral fat and abrogated beige-cell like phenotype. PMID: 28763300
  17. These results suggested that schisandrin A has a protective effect against LPS-induced inflammatory and oxidative responses in RAW 264.7 cells by inhibiting the NF-kappaB, MAPK and PI3K/Akt pathways; these effects are mediated, at least in part, by the activation of the Nrf2/HO-1 pathway PMID: 29115385
  18. Newborns appear to be protected from the pro-oxidative effects of free heme (FH), which may be mediated by heme binding and a higher absolute HO activity at baseline and after FH-mediated induction. PMID: 28926834
  19. Rosiglitazone Regulates TLR4 and Rescues HO-1 and NRF2 Expression in Myometrial and Decidual Macrophages in Inflammation-Induced Preterm Birth. PMID: 28322133
  20. this study shows that induction of heme oxygenas-1 attenuates NLRP3 inflammasome activation in lipopolysaccharide-induced mastitis in mice PMID: 28938188
  21. DADLE was able to significantly improve hepatic I/R injury in mice, and the specific mechanism may be associated with the Nrf2/HO1 signaling pathway. PMID: 28901476
  22. HO-1 role in the feedback response to blood carbon monoxide depletion PMID: 27057920
  23. Pretreatment with Zinc L-carnosine was able to activate Nrf2/HO-1 signaling pathway, thus suppressing the expression of inflammatory mediators, such as NO and iNOS in LPS-induced RAW 264.7 cells. PMID: 28697633
  24. Study demonstrated that a higher level of HO-1 associated with higher levels of injury severity, histological lesions and behavioral deficits in males than in females was induced by striatal ferrous citrate-infusion, which simulates iron overload in the striatum after intracerebral hemorrhage. PMID: 27198537
  25. these results indicate that MaR 1 protects against lung I/R injury through suppressing oxidative stress. The mechanism is partially explained by activation of the Nrf-2-mediated HO-1 signaling pathway. PMID: 28751936
  26. Splenic Ly6C(hi) monocytes contribute to adverse late post-ischemic left ventricular remodeling in heme oxygenase-1 deficient mice. PMID: 28534119
  27. findings suggest that HO-1 protects against I/R-induced hepatic injury via regulation of mitochondrial QC by PGAM5 signaling. PMID: 29524517
  28. this study shows that heme oxygenase 1 affects granulopoiesis in mice through control of myelocyte proliferation PMID: 28576353
  29. HO-1(pos) /CD169(neg) macrophages in jejunal serosa and at Auerbach's plexus up-regulated by lipopolysaccharide PMID: 27860408
  30. The results demonstrated that restoration of Brg1 during reperfusion could enhance Nrf2-mediated inducible expression of HO-1 during hepatic ischemia-reperfusion injury to effectively increase antioxidant ability to combat against hepatocytes damage. PMID: 28569786
  31. report that TLR signaling involving MyoD88 has a negative role in egress of HSPCs from BM into PB as TLR signaling enhances expression of HO-1 in hematopoietic cells PMID: 27560112
  32. Taken together, these findings suggest that 2,3,5,4'-Tetrahydroxystilbene-2-O-beta-D-glucoside (TSG) enhances mitochondrial biogenesis and function mainly via activation the HO-1. TSG can be developed as a potential drug for treatment of inflammatory diseases. PMID: 28473878
  33. The in vitro study illustrated that the anti-inflammatory effects of RA-XII were partially reversed following Nrf2 and HO-1 inhibition. Together, these findings strongly suggested that RA-XII is a potential agent against acute kidney injury. PMID: 29277609
  34. mRNA and protein levels of heme oxygenase-1 (HO-1)aresignificantly increased by Melaleuca alternifolia oil via p38 and JNK MAPK activation. PMID: 29121804
  35. Together with results showing involvement of TTF-1 in the TNF-alpha-induced increase in interleukin 1 beta and monocyte chemotactic protein 1 production, this study suggests that TTF-1 plays an important role in the mouse hypothalamus TNF-alpha-induced inflammatory response for regulating HO-1 gene expression. PMID: 29305861
  36. Curtailment of glial HO-1 transduction at strategic points of the life course may confer neuroprotection in human degenerative and developmental central nervous system disorders. PMID: 28746897
  37. Results indicate the essential roles of heme oxygenase-1 (HO-1) in suppressing the pathogenesis of abdominal aortic aneurysm (AAA), suggesting targeting HO-1 might be a promising therapeutic strategy for AAA. PMID: 27626316
  38. inadequate HO-1 in striatal astrocytes might contribute to the limited antioxidant defense and dopaminergic neuron degeneration in PD, and preferential HO-1 activation in striatal astrocytes might be neuroprotective. PMID: 26385576
  39. results indicate that high expression of HO-1 may reduce the severity of acute graft-versus-host disease by regulation of the TH17/Treg balance PMID: 27168057
  40. YZH-106 induced p38 MAPK and ERK1/2 phosphorylation, which led to the activation of erythroid 2-related factor 2 (Nrf2) that up-regulated heme oxygenase-1 (HO-1) expression in addition to other genes. PMID: 27107768
  41. our data indicate that luteolin diminishes the proinflammatory mediators NO, inflammatory cytokines and the expression of their regulatory genes, iNOS and COX-2, in PRV-infected RAW264.7 cells by inhibiting STAT1/3 dependent NF-kappaB activation and inducing Nrf2mediated HO-1 expression. PMID: 27016074
  42. we demonstrate that RG induces HO-1 expression by promoting phosphorylation of Nrf2 at Ser40 through activation of the ERK1/2 and JNK cascade in macrophages. PMID: 28257879
  43. We conclude that 1) CIH induces expression of HO-1 in the C1 and pre-BotC regions within 1 day and 2) HO-1 is necessary for hypoxia respiratory response and contributes to the maintenance of the hypoxic sigh responses and baseline sympathetic activity during CIH. PMID: 27609199
  44. this study demonstrates that ammonia stimulates the expression of HO-1 in endothelial cells via the ROS-Nrf2 pathway, and that the induction of HO-1 contributes to the cytoprotective action of ammonia by generating carbon monoxide. Moreover, it identifies ammonia as a potentially important signaling gas in the vasculature that promotes endothelial cell survival. PMID: 27867098
  45. HO-1 influences granulopoiesis through regulation of myelocyte proliferation. It is accompanied by changes in expression of transcriptionally active C/EBPbeta protein. PMID: 27817989
  46. EET-mediated increase in HO-1 levels require PGC-1alpha expression PMID: 27418542
  47. Downregulation of inducible NO synthetase (iNOS) resulted in downregulation of heme oxygenase 1 (HO-1), and, conversely, upregulation of iNOS enhanced HO-1 activity. PMID: 27752990
  48. Data suggest the a decrease in migration of hematopoietic stem progenitor cells (HSPCs) can be explained by impaired calcium release in phospholipase C-beta2 (PLC-beta2) knockout (KO) mice and a high baseline level of heme oxygenase 1 (HO-1), an enzyme that negatively regulates cell migration. PMID: 27704316
  49. HO-1 expression is upregulated by hydrogen-rich water in a mouse model of in fl ammatory bowel disease, which also inhibits inflammatory factors, and oxidative stress and ER stress PMID: 28293084
  50. study demonstrates that human respiratory syncytial virus (hRSV) infection can be modulated by the expression of HO-1 both in vitro and in vivo; thus, HO-1 activity may play a critical role during hRSV infection PMID: 28566367

Show More

Hide All

Subcellular Location
Microsome. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Heme oxygenase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*