Recombinant Mouse Insulin-1(Ins1)

In Stock
Code CSB-YP355623MO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P01325
Lead Time 3-7 business days
Relevance Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Research Area others
Source Yeast
Gene Names Ins1
Protein Names Recommended name: Insulin-1Cleaved into the following 2 chains: 1. Insulin-1 B chain 2. Insulin-1 A chain
Expression Region 25-108aa
Tag Info N-terminal 6xHis-tagged and C-terminal Myc-tagged
Mol. Weight 13.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Subcellular Location Secreted
Protein Families Insulin family
Database Links

KEGG: mmu:16333

STRING: 10090.ENSMUSP00000049095

UniGene: Mm.46269

Q&A and Customer Reviews

Q&A
Q:

Has CSB-YP355623MO been tested in cell culture?

A:
Thanks for your inquiry.
We haven't tested this protein in cell culture.
Q:

I have some problems in the development of the immunoassay to detect mouse insulin. Our antibodies are produced against recombinant human insulin, but they also react with mouse insulin (affinity tested). However, once I perform the immunoassay I could not see any specific signal, all signal is like background noise. I¡¯m not sure if either insulin or one of the antibodies is not working. However, I have some questions regarding recombinant mouse insulin that I hope you could answer,
Insulin purity was assessed by SDS-PAGE, addressing 85 % of purity, I don¡¯t understand why stained gel only shows one single band, theoretically there are other proteins/peptides, which could show more other bands in SDS-PAGE, right? . In this sense, if insulin expected band should be at 13 kDa (in you datasheet), why stained gel shows a single band at 21 kDa. I guess that this insulin is suitable as a standard/calibrator for immunoassays development, right? (Of course, always depending on the antibodies used).

A:
Thanks for your inquiry.
1.Our QC standard is over 85%,you can see from the COA that the purity is 90%, the MW in theory is 13kDa, the observed MW is 21kDa. The reason is because the yeast recombinant expression have extra galactosylated modification (mainly N-type high mannose modification). We have write the reason of the difference on the COA.
2.It can be used as the Elisa standard, but need a correct matched antibody,
① species of origin, the protein mouse and human sequence similarity is 81% is not very high, we are not 100% confirm it can be used cross-reaction
②The source of the immunogen is also important, the immunogen and the detection of the protein is best from the same expression system, we have encountered several times, that different systems expressed protein and antibody binding reaction is not the same.
We also have the antibody of human species (CSB-PA3589A0Rb), and have CSB-YP355623MO with the same batch in stock, while the E.coil system expression (CSB-EP355623MO) also have in stock. We are preparing do the WB test, we will send you the results once we get it.
Customer Reviews

Related Products

Ins1 Antibodies

Ins1 Antibodies for Mus musculus (Mouse)

Ins1 Proteins

Ins1 Proteins for Mus musculus (Mouse)

Ins1 ELISA Kit

Ins1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.