Recombinant Mouse Interleukin-13 (Il13)

Code CSB-BP011590MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP011590MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Il13; Il-13; Interleukin-13; IL-13; T-cell activation protein P600
Species
Mus musculus (Mouse)
Expression Region
19-131
Target Protein Sequence
APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Gene References into Functions
  1. S1PR2 facilitates lung fibrosis through the mechanisms involving augmentation of IL-13 expression and its signaling in BALF cells. PMID: 29782549
  2. Combined blockade of the IL-13 and IL-33 pathways leads to a greater inhibition of type 2 inflammation over inhibition of either pathway alone. PMID: 27697499
  3. Both pre- and post-transcriptional processes may be involved in the AR modulation of ILC2 IL-5 and IL-13 production. PMID: 28982732
  4. the endothelial barrier was preserved in respiratory epithelium isolated from MCU-/- mice after exposure to IL-13. In the ovalbumin-model of allergic airway disease, MCU deficiency resulted in decreased apoptosis within the large airway epithelial cells. Concordantly, expression of the tight junction protein ZO-1 was preserved, indicative of maintenance of epithelial barrier function PMID: 29225050
  5. controls the rate of epithelial cell movement through the epidermis and acts as a molecular bridge between intraepithelial lymphocytes and epithelial cells PMID: 27357235
  6. results demonstrate that IL-13 is a major regulator of radiation-induced lung injury and demonstrates that strategies focusing on IL-13 may be useful in screening for timely delivery of anti-IL-13 therapeutics. PMID: 28004808
  7. Using a mouse model of Th2-mediated inflammation induced by OVA-allergen, this study observed elevated lung amounts of IL-13 and IL-4 accompanied by increased autophagosome levels, determined by LC3BII protein levels and immunostaining. PMID: 28982074
  8. Metaplasia induction and macrophage polarisation after parietal cell loss is coordinated through a cytokine signalling network of IL-33 and IL-13, linking a combined response to injury by both intrinsic mucosal mechanisms and infiltrating M2 macrophages. PMID: 28196875
  9. IL-13 is able to signal independent of the IL-4Ra chain in AD (atopic dermatitis), which may lead to the identification of molecular pathways downstream of IL-13 signaling that could be targeted in future therapies for AD. PMID: 26896776
  10. the presence of interleukin-13 (IL-13), which can convert inflammatory into Ym1+ alternatively activated macrophages, at (acinar-to-ductal metaplasia [ADM]), which then gives rise to pancreatic intraepithelial neoplasia lesions, is reported. PMID: 28514653
  11. Data indicate that interleukin-33 (IL-33)-induced Interleukin-13 (IL-13) production by type-2 helper T cells (Th2 cells) Is dependent on epidermal growth factor receptor (EGFR) expression. PMID: 29045902
  12. this study shows that environmental IL-13 plays a role in conditioning early thymic progenitors lineage choice, which would impact T cell development PMID: 28893952
  13. IL-4 and IL-13 are required to effectively polarize macrophages/dendritic cells to an M2a phenotype and to promote recovery from acute kidney injury. PMID: 27745702
  14. this study shows that ST2 regulates early IL-13 production in fungus-induced allergic airway inflammation PMID: 26555705
  15. These observations suggest that IL-4 and IL-13 likely operate through the Heteroreceptor and influence Th17 cells to convert to Th1 cells and to acquire increased sensitivity to suppression, leading to control of immune-mediated CNS inflammation. PMID: 28801358
  16. MIF-deficient mice have reduced Nippostrongylus brasiliensis burden and mounted an enhanced type 2 immune response, including increased Gata3 expression and IL-13 production in the mesenteric lymph nodes PMID: 27049059
  17. findings suggest that a leukotriene B4 receptor-2-linked cascade plays a pivotal role in LPS/TLR4 signaling for IL-13 synthesis in mast cells, thereby potentially exacerbating allergic response. PMID: 28600286
  18. Study found IL-13 to be critically involved in the development of chemical-induced asthma, as shown by using IL-13 KO mice, and more specifically in the effector phase as confirmed by anti- IL-13 antibody treatment. PMID: 28704401
  19. these studies show that fibrosis, steatosis, cholestasis, and ductular reaction are simultaneously controlled but distinctly regulated by interleukin-13 signaling PMID: 27421703
  20. Our data support that impaired clearance of inhaled allergens triggering IL-13 production by multiple cell types in the airways plays an important role in the pathogenesis of type 2 airway inflammation and suggests therapeutic improvement of mucociliary clearance as a novel treatment strategy for children with allergen-induced asthma. PMID: 27865862
  21. this study shows that wild-type mice develop an eosinophilic Th2 airway disease in response to Alternaria alternata exposure, whereas IL-13-deficient mice exhibit a primarily neutrophilic response PMID: 27815425
  22. this study shows that IL-17A contributes to asthma pathophysiology by increasing the capacity of IL-13 to activate intracellular signaling pathways, such as STAT6 activation PMID: 27417023
  23. RCM-1 reduced IL-13 and STAT6 (signal transducer and activator of transcription 6) signaling and prevented the expression of the STAT6 target genes Spdef and Foxa3, which are key transcriptional regulators of goblet cell differentiation. PMID: 28420758
  24. IL-13 suppressed both the activation-induced apoptosis of CD4(+) T cells and the expression of p53 and FasL. PMID: 26189367
  25. We clearly show that miR-155 has a previously unknown direct regulatory role in the ILC2 subset that affects IL-33 receptor expression, IL-33 responsiveness, and IL-13 production as well as proliferation capability, possibly due to defects in GATA-3 function. PMID: 27492144
  26. The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 downregulates claudin-18. These data also suggest that the loss of claudin-18 is associated with increased sensitization to aeroantigens and airway responsiveness PMID: 27215490
  27. Studies in colonic T84 cell monolayers revealed that barrier disruption by the colitis-associated Th2-type cytokines, IL-4 and IL-13, down-regulates matriptase as well as prostasin through phosphorylation of the transcriptional regulator STAT6 PMID: 28490634
  28. These data demonstrate that multiple pathogenic strains of RSV induce IL-13-producing group 2 innate lymphoid cell proliferation and activation through a TSLP-dependent mechanism in a murine model and suggest the potential therapeutic targeting of TSLP during severe RSV infection. PMID: 27156176
  29. The soluble antigen from A. cantonensis could promote the Chil3 expression in macrophage and microglial cell lines induced by interleukin-13. PMID: 27256220
  30. The reduction in fibrosis observed when IL-13 signalling is suppressed is not dependent on increased IFN-gamma activity. Instead, by reducing compensatory increases in type 1-associated inflammation, therapeutic strategies that block IFN-gamma and IL-13 activity simultaneously can confer greater protection from progressive fibrosis than IL-13 blockade alone. PMID: 27125685
  31. The IL-23/IL-17 axis plays a critical role in the immunopathology of hepatic amebiasis. IL-13 secreted by CD11b(+)Ly6C(lo) monocytes may be associated with recovery from liver damage. PMID: 26809113
  32. PLD1 activation enhanced binding of ROCK1 to ATF-2 and leads to increased expression of IL-13 PMID: 26335962
  33. Macrophages are critical to the maintenance of IL-13-dependent lung inflammation and fibrosis. PMID: 25921340
  34. IL-25 and CD4(+) TH2 cells enhance type 2 innate lymphoid cell-derived IL-13 production, which promotes IgE-mediated experimental food allergy. PMID: 26560039
  35. Placenta growth factor augments airway hyperresponsiveness via leukotrienes and IL-13. PMID: 26690703
  36. Natural helper cells contribute to pulmonary eosinophilia by producing IL-13 via IL-33/ST2 pathway in a murine model of respiratory syncytial virus infection PMID: 26044350
  37. review of IL-4 and IL-13 mast cell immunity and detail of the differences that exist between mouse and human mast cell responses to IL-4 and IL-13 [review] PMID: 26088754
  38. Data (including data from studies in knockout/transgenic mice) suggest T cell-derived IL4/IL13 are required for immunologic memory and IgE response to helminth Nippostrongylus brasiliensis but are not required for expansion/proliferation of B cells. PMID: 26523376
  39. Curcumin up-regulates mRNA and protein levels of IL-4 and IL-13 PMID: 25944087
  40. These data indicate that distal airways might be less sensitive to IL-13-induced GC metaplasia and mucus production through lower expression of IL-13Ralpha1 and attenuated activation of downstream signalling. PMID: 25772331
  41. IL-13 induces miR-142-5p and downregulates miR-130a-3p in macrophages, regulating macrophage profibrogenic gene expression in chronic inflammation. PMID: 26436920
  42. IL-4 and IL-13 have a critical role in innate immune cells for protective immunity against gastrointestinal helminths. PMID: 25336167
  43. These data demonstrate that dysregulated IL-25 expression contributes to lipid accumulation, whereas exogenous IL-25 protects against hepatic steatosis through IL-13 activation of STAT6. PMID: 26423151
  44. TH2 cells and their cytokines IL-4 and IL-13 regulate formation and function of lymphatic vessels. PMID: 25648335
  45. Mice with experimental Schistosoma-induced pulmonary hypertension (PH) had evidence of increased IL-4 and IL-13 signaling. IL-4(-/-)IL-13(-/-) mice, but not single knockout IL-4(-/-) or IL-13(-/-) mice, were protected from Schistosoma-induced PH. PMID: 26192556
  46. regulates the expression of IL-17A in HIV-specific CD8 T cells following immunizations PMID: 25493691
  47. These data establish for the first time a molecular mechanism by which Mac-1 regulates the signaling activity of IL-13 in macrophages. PMID: 26160172
  48. Acidic pH augments Fc-epsilon-RI-mediated production of IL-6 and IL-13 in mast cells. PMID: 26196745
  49. conjunctival goblet cells are IL-13 responsive cells that produce factors known to maintain epithelial barrier, stimulate mucin production, and modulate immune response in nonocular mucosa when treated with IL-13. PMID: 26132778
  50. Enhanced IL-13 production by T cells can play a causative role in the exocrinopathy observed in Id3 knockout mice. PMID: 25010390

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-4/IL-13 family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1