Recombinant Mouse Interleukin-18(Il18)

In Stock
Code CSB-YP011608MOb0
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P70380
Lead Time 3-7 business days
Relevance Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Research Area Immunology
Source Yeast
Gene Names Il18
Protein Names Interferon gamma-inducing factor
Expression Region 1-192aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 24.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Subcellular Location Secreted
Protein Families IL-1 family
Database Links

KEGG: mmu:16173

STRING: 10090.ENSMUSP00000137193

UniGene: Mm.1410

Pathway Inflammasome Signaling
NOD-like receptor signaling pathway

Related Products

Il18 Proteins

Il18 Proteins for Mus musculus (Mouse)

Il18 ELISA Kit

Il18 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.