Recombinant Mouse Kit ligand (Kitlg), partial (Active)

In Stock
Code CSB-MP012376MO1
Abbreviation Recombinant Mouse Kitlg protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit(CSB-MP012375MO). The EC50 is 15.57-20.95 ng/mL. Biological Activity Assay
  • Activity
    The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit(CSB-MP012375MO). The EC50 is 15.57-20.95 ng/mL.
②The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL.
Target Names
Uniprot No.
Alternative Names
Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor (MGF); Steel factor; Stem cell factor (SCF); c-Kit ligand; Soluble KIT ligand (sKITLG); KitlgKitl, Mgf, Sl, Slf
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
26-189aa
Target Protein Sequence
KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Mol. Weight
19.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Gene References into Functions
  1. These findings support the view that SCF, in addition to its pro-proliferative effects, is important for the differentiation of MCs. PMID: 27619074
  2. In vitro, SCF induced the phosphorylation of p38 MAPK and cofilin, leading to the migration of cardiac stem cells. PMID: 28986094
  3. MAPK3/1 participates in primordial follicle activation through mTORC1-KITL signaling. PMID: 28218391
  4. MicroRNA-205 maintains T cell development following stress by regulating Foxn1 and its two regulated targets, stem cell factor and ccl25, following stress. PMID: 27646003
  5. Bone marrow adipocytes synthesize SCF, promoting hematopoietic stem cell proliferation/regeneration. PMID: 28714970
  6. SCF/c-kit signaling may potentiate chronic hypoxia-induced vascular remodeling by modulating ERK activation. Inhibition of c-kit activity may be a potential strategy to alleviate PH PMID: 26705118
  7. Kit ligand regulates the subcellular localization of FOXO3 in the neonatal mouse ovary. PMID: 26507072
  8. The results of this study indicate that c-kit/KITL signalling also occurs in the human ovary, as established in various animal models, and may involve previously unknown autocrine signalling PMID: 26008799
  9. Streptozotocin-induced diabetes was induced in cKit-mutant mice with low cKit expression in their endothelial cells. PMID: 26978025
  10. study suggests extracellular HMGB1 participates in NLRP3 inflammasome activity and regulates IL-1beta associated sterile inflammation induced by MWCNT PMID: 25779020
  11. These results show that mast cell deficiency, in the absence of Kit mutations, plays no role in the regulation of weight gain or insulin resistance. PMID: 25955205
  12. Stem cell factor is essential for preserving reconstitution capacity of ex vivo expanded cord blood CD34(+) cells in Immunocompromised mice. PMID: 25899394
  13. High stem cell factor expression is associated with breast cancer metastasis. PMID: 23577751
  14. Cardiomyocyte-specific overexpression of hSCF promotes epicardial activation and myocardial arteriogenesis post MI. PMID: 25107671
  15. SCF+G-CSF treatment in chronic stroke remodels neural circuits in the aged brain PMID: 23750212
  16. Data reveal that SCF disrupts the endothelial adherens junction and enhances vascular leakage, and suggest that anti-SCF/cKit therapy may hold promise as a potential therapy for the treatment of hyperpermeable vascular diseases. PMID: 24790137
  17. results show that the c-kit/mSCF/MMP-9 axis regulates IL-23 gene expression in DCs to control IL-17 production in the lung. PMID: 24829419
  18. Data indicate that insulin-like growth factor-1 (IGF1) stimulated s tem cell factor (Kitl/KITLG) protein and mRNA expression and promoter activity by activating several signaling pathways. PMID: 24116170
  19. Wnt7a triggers melanocyte stem cell differentiation through beta-catenin activation, and Kitl might induce following migration of melanoblasts to epidermis PMID: 23702581
  20. data and the identification of c-kit/Kit-ligand clusters at cell contacts suggest that membrane-bound Kit ligand captures cell surface-expressed c-kit PMID: 22637532
  21. A major role is described for SCF in the homeostatic control of mast cell activation with potential relevance to mast cell-driven disease and the development of novel approaches for the treatment of allergic disorders. PMID: 22529299
  22. Proliferation and the basal/luminal cell composition of cells isolated from the proximal region of prostatic ducts (the stem cell niche) is regulated in part by opposing effects of stem cell factor and endogenous TGF-beta. PMID: 22024978
  23. Data show tumor-promoting potential of mast cells could be augmented by molecules released from damaged tumor cells through cooperative stimulation of stem cell factor (SCF) and ligand for Toll-like receptor 4 (TLR4). PMID: 21877248
  24. membrane-bound Steel factor controls germ cell motility within a "motility niche" that moves through the embryo with the germ cells PMID: 21998739
  25. These experiments revealed a new function of stem cell factor in chemokine receptor coupling. PMID: 20427772
  26. The altered sorting of KitL is dispensable for hematopoietic and melanogenic lineages, yet is crucial in the testicular environment, where the basal membranes of adjacent polarized Sertoli cells form a niche for the proliferating spermatogonia. PMID: 19874813
  27. Results suggest that the c2j tyrosinase defect can be rescued in part by stem cell factor in the ears and tail. PMID: 19682281
  28. diabetic mice show a decline in the number of interstitial cells of Cajal and impairment in the ultrastructures, and these abnormalities are attributed to a deficiency in the endogenous SCF but are not related to hyperglycemia PMID: 19875700
  29. cell surface form of SCF mainly promotes the proliferation of hemopoietic stem cells PMID: 11811778
  30. data show that Kitl induces telomerase activity in mitotic spermatogonia and increases the mRNA levels of both the catalytic subunit form and the telomerase RNA template PMID: 11950883
  31. intracellular signaling pathway of SCF/KIT-mediated cell migration PMID: 11964302
  32. role of fibronectin and stem cell factor in melanocyte growth, differentiation and migration PMID: 12028583
  33. involvement of Kit/SCF at different stages of spermatogenesis PMID: 12080001
  34. involved in the induction of LTP and the blockade of LTP by rmSCF might be due to an occlusion of SCF/c-kit signaling PMID: 12137920
  35. different isoforms of SCF may use different biochemical pathways in stimulation of survival and/or proliferation of erythroid cells PMID: 12149209
  36. Stem cell factor radioprotection is due to PLC gamma 1-dependent negative regulation of ionizing radiation induced neutral sphingomyelinase stimulation PMID: 12149210
  37. stem cell factor (kit ligand) stimulated neurogenesis in vitro and in vivo PMID: 12163450
  38. identification of an allelic series of mutations in the kit ligand gene PMID: 12242244
  39. effects of ethylnitrosourea-induced Kitl point mutations on survival and peripheral blood cells of Kitl(Steel) mice PMID: 12242245
  40. SCF is a potent eosinophil degranulator and activator that may play a number of roles during an inflammatory/immune response. PMID: 12453875
  41. Levels of E2A protein expression in B cell precursors are stage-dependent and inhibited by stem cell factor, mainly from posttranscriptional regulation. PMID: 12482503
  42. data suggest that FoxO3 plays an important role in kit ligand-mediated survival of hematopoietic progenitors PMID: 12691919
  43. Phosphatidylinositol 3-kinase is essential for kit ligand-mediated survival. PMID: 12960281
  44. Stem cell plays a significant role in restoring hepatocyte proliferation in IL-6 knockout mice following hepatectomy. PMID: 14597766
  45. that although transmembrane-SCF does not appear to play a role in the homing of transplanted cells to the bone marrow, it is critical in the lodgment and detainment of HSC within their hemopoietic "niche." PMID: 14662336
  46. SLF and SDF-1alpha have a synergistic effect in fetal hematopoietic stem cells PMID: 15024423
  47. XPA (-/-), SCF-Tg mice did not develop skin cancers after repeated exposures to UVB for 30 wk at a total dose of 72 J per cm(2) PMID: 15191564
  48. C-terminal valine defines a specific endoplasmic reticulum export signal in Kitl PMID: 15475566
  49. Cessation of SCF treatment results in the rapid reduction of cutaneous skin mast cell populations by apoptosis. PMID: 15502858
  50. role for SCF in cell migration and survival in the developing cortex; SCF is a survival factor, but not a mitogen or a differentiation factor for neural stem cells PMID: 15530856

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cytoplasm, cytoskeleton. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.
Protein Families
SCF family
Tissue Specificity
Expressed in the cochlea.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*