Recombinant Mouse Kit ligand(Kitlg),partial (Active)

In Stock
Code CSB-AP004071MO
Product Type Growth Factor
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P20826
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Kit ligand;Hematopoietic growth factor KL;Mast cell growth factor;MGF;Steel factor;Stem cell factor;SCF
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by the dose-dependent stimulation of TF-1 cells is less than 10 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Research Area Immunology
Source E.coli
Gene Names Kitlg
Expression Region 26-189aa
Tag Info Tag-Free
Mol. Weight 18.4 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Single-pass type I membrane protein, Cytoplasm, cytoskeleton, Cell projection, lamellipodium, Cell projection, filopodium, SUBCELLULAR LOCATION: Soluble KIT ligand: Secreted
Protein Families SCF family
Tissue Specificity Expressed in the cochlea.
Database Links

KEGG: mmu:17311

STRING: 10090.ENSMUSP00000100920

UniGene: Mm.45124

Pathway MAPK signaling pathway
Melanogenesis
PI3K-Akt signaling pathway
Ras signaling pathway
Fc gamma R-mediated phagocytosis
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

Kitlg Proteins

Kitlg Proteins for Mus musculus (Mouse)

Kitlg ELISA Kit

Kitlg ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.