Purity

≥ 95% as determined by SDS-PAGE.≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit at 2 μg/mL can bind Mouse Kitlg (CSB-MP012376MO1d9). The EC50 is 19.35-24.80 ng/mL.
②Mouse Kitlg (CSB-MP012376MO1d9) captured on Protein A Chip can bind Recombinant Mouse Kit with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

Kit

Uniprot No.

P05532-2

Alternative Names

Mast/stem cell growth factor receptor Kit; SCFR; EC 2.7.10.1; Proto-oncogene c-Kit; Tyrosine-protein kinase Kit; CD antigen CD117

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

25-523aa

Target Protein Sequence

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKEQIQAHTLFTP

Mol. Weight

56.9 kDa

Protein Length

Partial of Isoform 2

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The extracellular domain of mouse Kit (aa 25–523) mediates stem cell factor binding and initiates signaling cascades central to hematopoiesis, melanogenesis, and mast cell development, making it a critical target in cancer biology and developmental research. Mammalian expression preserves native glycosylation and disulfide architecture, yielding a protein that binds mouse stem cell factor with an EC50 of 19.35–24.80 ng/mL in functional ELISA and demonstrates a 15.1 nM affinity constant by surface plasmon resonance, quantitative metrics that support its use in ligand-binding assays, competitive inhibition screens, and therapeutic antibody epitope mapping. This conformational integrity enables reliable screening of small-molecule or biologic inhibitors targeting the Kit receptor pathway, as well as validation of blocking antibodies in oncology-focused drug discovery programs. Purity exceeding 95% by both SDS-PAGE and SEC-HPLC, combined with endotoxin levels below 1.0 EU/μg, aligns with standards expected in quantitative binding studies and antibody development workflows.

Code	CSB-MP012375MO1
Abbreviation	Recombinant Mouse Kit protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit at 2 μg/ml can bind Mouse Kitlg (CSB-MP012376MO1d9). The EC₅₀ is 19.35-24.80 ng/mL. Biological Activity Assay Activity Mouse Kitlg (CSB-MP012376MO1d9) captured on Protein A Chip can bind Recombinant Mouse Kit with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay The purity of Kit was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Mast/stem cell growth factor receptor Kit (Kit), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage