Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP001666MO |
| Product Type | Recombinant Protein |
| Size |
US$2474Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P27106 |
| Lead Time | 3-7 business days |
| Relevance | This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Anti-Muellerian hormone ;AMH;Muellerian-inhibiting substance ;MIS |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
| Research Area | Others |
| Source | Yeast |
| Gene Names | Amh |
| Protein Names | Recommended name: Muellerian-inhibiting factor Alternative name(s): Anti-Muellerian hormone Short name= AMH Muellerian-inhibiting substance Short name= MIS |
| Expression Region | 450-552aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 13.3kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. |
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age o |
| Database Links |
STRING: 10090.ENSMUSP00000043153 UniGene: Mm.376094 |
| Pathway |
cAMP signaling pathway
Hippo signaling pathway TGF-beta signaling pathway |
Can you please tell me the concentration for CSB-YP001666MO lot # 03724?
Amh Antibodies for Mouse
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA001666YD01MO | Amh Antibody, Biotin conjugated | Mouse | ELISA |
| CSB-PA001666YC01MO | Amh Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA001666YB01MO | Amh Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA001666YA01MO | Amh Antibody | Mouse, Human | ELISA, WB, IHC |
Amh Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP001666MO | Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial | E.coli |
| CSB-BP001666MO CSB-MP001666MO |
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial | Baculovirus Mammalian cell |
Amh ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E13156m | Mouse anti-Mullerian hormone (AMH) ELISA kit | serum, plasma, tissue homogenates | 0.25 ng/mL |
Recombinant Human Thioredoxin-like protein 1(TXNL1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rabbit Integrin beta-8(ITGB8),partial,Yeast
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Mouse L-dopachrome tautomerase(Dct),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Tryptophan--tRNA ligase, cytoplasmic(WARS)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Ras-related protein Rab-5C(RAB5C)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear transport factor 2(NUTF2)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
