Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial


In Stock
Code CSB-YP001666MO
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P27106
Lead Time 3-7 business days
Relevance This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Anti-Muellerian hormone ;AMH;Muellerian-inhibiting substance ;MIS
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Research Area Others
Source Yeast
Gene Names Amh
Protein Names Recommended name: Muellerian-inhibiting factor Alternative name(s): Anti-Muellerian hormone Short name= AMH Muellerian-inhibiting substance Short name= MIS
Expression Region 450-552aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 13.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Subcellular Location Secreted
Protein Families TGF-beta family
Tissue Specificity Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age o
Database Links

STRING: 10090.ENSMUSP00000043153

UniGene: Mm.376094

Pathway cAMP signaling pathway
Hippo signaling pathway
TGF-beta signaling pathway

Q&A and Customer Reviews

Q&A
Q:

Can you please tell me the concentration for CSB-YP001666MO lot # 03724?

A:
Thanks for your inquiry. The protein concentration of lot # 03724 is 0.1 mg/ml.
Customer Reviews

Related Products

Amh Antibodies

Amh Antibodies for Mouse

Amh Proteins

Amh Proteins for Mus musculus (Mouse)

Amh ELISA Kit

Amh ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.