Home
Protein
Recombinant Protein
Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

^{In Stock}

Code	CSB-YP001666MO
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Amh

Uniprot No.

P27106

Research Area

Others

Alternative Names

Amh; Muellerian-inhibiting factor; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

450-552aa

Target Protein Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

13.3kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

An NDA sequence corresponding to the 450-552aa of mouse Muellerian-inhibiting factor (Amh) was expressed with an N-terminal 6xHis-tag in the yeast. The resulting protein is the Recombinant partial-length Mouse Mullerian-inhibiting factor (Amh), which has a predicted molecular weight of 13.3 kDa. And it was purified by SDS-PAGE and reached up to 90% in purity. This Amh protein is in-stock, allowing the purchase of no waiting period of product preparation. It may be used as an immunogen for antibody production and in the studies related to sexual differentiation and germ development.

Amh is a gonadal hormone belonging to the transforming growth factor-beta family. It is restrictedly expressed in Sertoli cells of the fetal and adult testis and granulosa cells of the postnatal ovary. And it plays a significant role in sexual differentiation and germ development. Lack of Amh during female fetal development leads to the development of the Muellerian duct system. And Amh serves as an inhibitor of follicular development and recruitment, which contributes to follicular arrest.
Elevated expression of Amh is correlated with the various reproductive and metabolic/endocrine alterations in polycystic ovary syndrome (PCOS).

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Can you please tell me the concentration for CSB-YP001666MO lot # 03724?

Thanks for your inquiry. The protein concentration of lot # 03724 is 0.1 mg/ml.

Target Background

Function

This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Tissue Specificity

Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age o

Database Links

STRING: 10090.ENSMUSP00000043153

UniGene: Mm.376094

Promotions