Home
Protein
Recombinant Proteins
Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

Recombinant Mouse Muellerian-inhibiting factor (Amh), partial

^{In Stock}

Code	CSB-EP001666MO
MSDS	MSDS
Size	US$422
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP001666MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Amh. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP001666MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Amh.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Amh

Uniprot No.

P27106

Research Area

others

Alternative Names

Amh; Muellerian-inhibiting factor; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

450-552aa

Target Protein Sequence

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

11.3kDa

Protein Length

Partial

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Empower your research with our Recombinant Mouse Amh protein, also known as Muellerian-inhibiting factor. Notably found in Mouse species, this protein is intricately involved in various biological processes.

Expressed in E.coli, the Amh protein is presented in its partial form (450-552aa), providing a substantial portion of this remarkable molecule. Furthermore, our product is tag-free, allowing for a more natural interaction with other molecules in your experiments. Assuring a purity greater than 90% as determined by SDS-PAGE, we offer the high-quality standards you require for your research. Choose from either a liquid format for immediate use or a lyophilized powder for a longer shelf life, depending on your needs.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Can you please provide the following information on Recombinant Mouse Muellerian-inhibiting factor( Cat: CSB-EP001666MO) (Lot# 03699):
We would like to know if they can use ultra-pure water for the reconstitution of the anti mullerian hormone?

Thanks for your inquiry.I have confirmed with our technical support team that you could use ultra-pure water for the reconstitution of the anti mullerian hormone.

Target Background

Function

This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.

Subcellular Location

Secreted.

Protein Families

TGF-beta family

Tissue Specificity

Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age o

Database Links

STRING: 10090.ENSMUSP00000043153

UniGene: Mm.376094

Promotions