Your Good Partner in Biology Research
Tel : 301-363-4651
CCR8｜C5AR1｜CD24｜CLDN18.2｜CD20｜Proteinase K｜EGFR｜PD-L1｜CD276｜Exosome Isolation Kits
Your Good Partner in Biology Research
CCR8｜C5AR1｜CD24｜CLDN18.2｜CD20｜Proteinase K｜EGFR｜PD-L1｜CD276｜Exosome Isolation Kits
| Code | CSB-BP001666MO |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP001666MO-B |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-MP001666MO |
| Size | Pls inquire |
| Source | Mammalian cell |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | >85% (SDS-PAGE) |
| Target Names | Amh |
| Uniprot No. | P27106 |
| Research Area | Others |
| Alternative Names | Amh; Muellerian-inhibiting factor; Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS |
| Species | Mus musculus (Mouse) |
| Expression Region | 450-552aa |
| Target Protein Sequence | TGTDGPCALRELSVDLRAERSVLIPETYQANNCQGACAWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISAHHVPNMVATEC |
| Mol. Weight | 13kD |
| Protein Length | Partial |
| Tag Info | The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If
you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
| Form | Lyophilized powder |
| Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time
may differ from different purchasing way or location, please kindly consult your local distributors
for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
| Function (From Uniprot) |
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
|
| Subcellular Location | Secreted |
| Protein Families | TGF-beta family |
| Tissue Specificity | Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age o |
| Database Links |
STRING: 10090.ENSMUSP00000043153 UniGene: Mm.376094 |
