Recombinant Mouse Stromal cell-derived factor 1 (Cxcl12), partial

Code CSB-EP006242MO1
Abbreviation Recombinant Mouse Cxcl12 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Cxcl12; Sdf1; Stromal cell-derived factor 1; SDF-1; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF; Thymic lymphoma cell-stimulating factor; TLSF
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-89aa
Target Protein Sequence
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells.
Gene References into Functions
  1. superparamagnetic iron oxide nanoparticles also stimulated CXCR4 (C-X-C chemokine receptor type 4) expression and CXCR4-SDF-1 (Stromal cell-derived factor 1) signaling in mesenchymal stem cells. PMID: 29734748
  2. This study regarding high SDF-1 levels in our mouse model of ototoxicity would play a major role in the development of therapeutic agents using MSC homing. PMID: 29430461
  3. CXCL12-CXCR4 signalling is essential for the correct patterning of aortic arches and pulmonary arteries during development. PMID: 29016745
  4. Data (including data from studies in knockout mice) suggest that adipocyte autocrine function involving Sdf1 regulates insulin resistance; Sdf1 gene expression correlates with insulin-desensitized conditions in adipocytes but not other tissues (liver, skeletal muscle); adipocyte-specific ablation of Sdf1 enhances insulin sensitivity in adipose tissues and in whole body. PMID: 29581126
  5. postnatal CXCL12 signaling promotes a specific interneuron circuit that inhibits medial prefrontal cortex activity PMID: 27497284
  6. Study reports that stromal cell-derived factor-1alpha elevated or therapeutically administered in ischemic wounded tissue can stimulate both local endothelial cells (EC) and bone marrow-derived endothelial progenitor cells (EPC) to express reciprocally E-selectin/ligand pairs and thereby enhance EPC-EC interactions. PMID: 27713493
  7. suggest that miR-155 modulates SHIP-1 expression that subsequently affects CXCL12-CXCR4 signaling axis via Akt activation PMID: 28174416
  8. Authors produced recombinant CXCL12 and CXCL12(5-67) and evaluated their effect in murine adult NSCs migration and survival in vitro. We showed CXCL12(5-67) does not promote NSCs migration, but does induce cell death. PMID: 28623786
  9. Study demonstrates that CXCR4/CXCL12 axis can limit oxidative stress injury in hematopoietic stem cells (HSCs) by reducing mitochondrial oxidative stress. CXCL12 has a direct rescue effect on oxidative stress-induced HSC damage at the mitochondrial level. PMID: 27886253
  10. a defect of CXCL12 promoter histone acetylation may represent an additional process participating in CXCL12 expression extinction in colon cancer PMID: 28418886
  11. The structure of murine germinal centers (GC) and the localization of GC B cells are impaired when CXCL12 is unable to bind to cellular or extracellular surfaces. PMID: 28193885
  12. These findings indicate that the CXCL12alpha-CXCR4 axis plays an important role in the regeneration of the neuromuscular junction after motor axon injury. PMID: 28559442
  13. Here, we show that cabozantinib rapidly eradicates invasive, poorly differentiated PTEN/p53-deficient murine prostate cancer. This was associated with enhanced release of neutrophil chemotactic factors from tumor cells, including CXCL12 and HMGB1, resulting in robust infiltration of neutrophils into the tumor. PMID: 28274958
  14. nitration on Tyr7 under inflammatory conditions is a novel natural posttranslational regulatory mechanism of CXCL12 which may downregulate the CXCR4-mediated inflammatory and tumor-promoting activities of CXCL12 PMID: 27566567
  15. SDF-1 is secreted shortly after UPEC infection initiating immune cell accumulation. PMID: 28683322
  16. The data suggest that SDF-1beta provides synergistic effects supporting BMP-2-induced, BMSC-mediated bone formation and appears suitable for optimization of bone augmentation in combination therapy protocols. PMID: 26227988
  17. Hyaluronic acid-laminin hydrogels increase neural stem cell transplant retention and migratory response to SDF-1alpha in a manner critically dependent on signaling via the SDF-1alpha-CXCR4 axis. PMID: 27645115
  18. The Function of SDF-1-CXCR4 Axis in SP Cells-Mediated Protective Role for Renal Ischemia/Reperfusion Injury by SHH/GLI1-ABCG2 Pathway PMID: 27454381
  19. Adora2B stimulation promotes FGF2 and CXCL12 expression in FAP-positive melanoma-associated fibroblasts, contributing to the creation of a tumor-promoting microenvironment. PMID: 27590504
  20. CXCL12 in cardiomyocytes is not involved in cardiac development. * CXCL12 deficiency in cardiomyocytes improves outcome of myocardial infarction. * CXCL12 overexpression in cardiomyocytes worsens outcome of myocardial infarction. * CXCL12 increases fibrosis and invasion of Th1 cells in the heart after infarction. PMID: 27251706
  21. findings suggest that PECAM-1 enhances SDF-1-induced chemotaxis by augmenting and prolonging activation of the PI3K/Akt/mTORC1 pathway and Rap1 and that PECAM-1, at least partly, exerts its activity by inhibiting SDF-1-induced internalization of CXCR4 PMID: 28974577
  22. endothelial CXCR7+ cells regulate CXCL12 gradient direction by controlling concentrations near but not far from the vasculature. PMID: 29117251
  23. This study showed that release of BMP-2 and SDF-1alpha from heparinized MCM scaffolds allows for the reduction of the applied BMP-2 concentration since SDF-1alpha seems to enhance the osteoinductive potential of BMP-2. PMID: 27060915
  24. The results of this study suggested that enhanced interaction between STAT3 and p300 mediated the epigenetic upregulation of CXCL12 in dorsal horn neurons, which contributed to the antitubulin chemotherapeutics-induced persistent pain PMID: 28072604
  25. Dipeptidyl peptidase-4 inhibition, independent of glucagon-like peptide-1 receptor signaling, contributes to protection of the diabetic kidney through SDF-1-dependent antioxidative and antifibrotic effects and amelioration of adverse renal hemodynamics. PMID: 27475229
  26. High Cxcl12 expression is associated with Prostate Cancer. PMID: 28687617
  27. Authors demonstrate that targeting the SDF-1/CXCR4 pathway in the context of KLF10 deletion substantially suppresses PDAC progression PMID: 28581520
  28. Adipocytes promoted osteoclast differentiation, function and expression of adhesion-related molecules through the CXCL12/CXCR4 signalling pathway. PMID: 27868262
  29. these findings demonstrate that expression of Hmga2 cooperates with Jak2(V617F) in the pathogenesis of Mmyelofibrosis. PMID: 28637665
  30. Data demonstrated that sustained expression of CXCL12 by MSCs in the primary tumour site inhibits metastasis through reduction of CXCR7, while, in the presence of TGFbeta, this CXCL12 effect of MSCs on tumour cells is relieved. PMID: 27669436
  31. CXCL12 upregulation prior to stroke onset, and its actions following stroke, contribute to the endogenous, anti-inflammatory phenotype induced by repetitive hypoxic preconditioning PMID: 27006446
  32. Results suggest that SDF-1/CXCR4 signaling plays an important role in the dynamics associated with adult sub-ventricular zone lineage cell proliferation and differentiation. PMID: 27288704
  33. TNF plays an inhibitory role in modulating myocardial SDF-1 production and blockade of TNF signaling by ablation of TNFR1 and TNFR2 genes increased SDF-1 expression in the heart. These data expand on TNF signaling-initiated mechanisms in myocardium, which may lend a more complete understanding of SDF-1 and TNFR-derived actions in hopes of advancing ischemic heart injury treatments. PMID: 27979472
  34. CD26-cleavage skews CXCL12 towards beta-arrestin dependent recruitment through ACKR3 and destroys the CXCR4-mediated lymphocyte chemoattractant properties of CXCL12 in vivo PMID: 28322746
  35. these data highlight AnxA1 as a novel determinant of neutrophil maturation and the mechanisms behind blood neutrophil homing to BM via the CXCL12/CXCR4 pathway. PMID: 26892496
  36. CXCL12/CXCR4 regulates HA and LG following corneal suture placement, and provides a novel strategy to inhibit LG. Notably, the present study is the first to demonstrate evidence that CXCL12/CXCR4 modulates LG in a corneal suture-induced mouse model. PMID: 27121088
  37. the present study indicates that the CXCL12/CXCR4 signaling pathway is important during the development of cochleae in neonatal mice. PMID: 27052602
  38. crosstalk between astrocytic CXCL12 and microglial CXCR4 in the pathogenesis of neuropathic pain. PMID: 27030717
  39. Overexpression of SDF-1alpha could chemotaxize endothelial progenitor cells to reach local wounds, thus further accelerating angiogenesis in the transplant site PMID: 25853481
  40. A model of SDF-1 regulation in the hypoxia pathway was constructed; the underlying mechanisms of SDF-1 kinetics and a novel incoherent feed forward loop regulating SDF-1 expression were proposed. PMID: 26701884
  41. We showed that CXCL12, a potent chemoattractant for CXCR4-expressing NSPCs, was upregulated in the ischemic lesion of N-PRbeta-KO mice. PMID: 26435273
  42. DPP-4 inhibition may have direct protective effects on the post-myocardial infarction heart by inducing an antiapoptotic effect and inhibiting a decrease in vessel number through the SDF-1a/CXCR4-mediated STAT3 signaling pathway. PMID: 26739213
  43. findings demonstrate that Twist-1, which maintains BMSC at an immature state, endows them with an increased capacity for supporting hematopoiesis via direct activation of CXCL12 gene expression. PMID: 26718114
  44. confirm a pivotal role of the SDF-1/CXCR4/CXCR7 axis for chronic allograft vasculopathy development PMID: 26265085
  45. Time-dependent changes in endometrial hypoxia during menstruation correlated with the regulation of mRNAs encoding for the angiogenic genes Vegfa and Cxcl12. PMID: 26780953
  46. The results of this study findings the post-CNS-inflammation role of CXCL12 in augmenting the endogenous myelin/neuronal repair capacity in MS-like disease, likely via CXCL12/CXCR4 autocrine signaling. PMID: 26747276
  47. CXCR4/CXCL12 signaling may control movement of epithelial progenitors from the dental stem cell niche. PMID: 26246398
  48. our present study provided evidence that SDF-1 mediated CSCs migration through CXCR4 and CXCR7 via MEK/ERK and PI3K/Akt pathway PMID: 26578388
  49. Following fracture, a CXCL12(+)-BMP2(+) perivascular cell population is recruited along the endosteum. PMID: 25967044
  50. Data suggest that the conditional chemokine CXCL12 line can be used as a powerful tool to manipulate CXCL12 signaling and function in vivo. PMID: 26505253

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine alpha (chemokine CxC) family
Tissue Specificity
Highest expression levels detected in kidney, liver, spleen and muscle. Isoform Alpha is expressed ubiquitously but at varying levels, while isoform Beta displays tissue-specific expression, with expression detected in kidney, liver, heart, spleen and mus
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*