Recombinant Mouse Tissue factor(F3), partial

Code CSB-MP007928MO1
Abbreviation Recombinant Mouse F3 protein, partial
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
TF;Coagulation factor III;CD antigen CD142
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
29-251aa
Target Protein Sequence
AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
Gene References into Functions
  1. Tissue factor cytoplasmic domain is involved in TF-PAR-2 signalling initiating hepatic fibrosis and is a potential therapeutic target, as its deletion would not impact coagulation. PMID: 28883694
  2. Myeloid cell derived tissue factor dampens inflammation in acid-induced acute lung injury. PMID: 28509332
  3. Ticagrelor, but not clopidogrel, reduces arterial thrombosis via endothelial tissue factor suppression. Ticagrelor reduced TNF-alpha-induced TF expression via proteasomal degradation. PMID: 28028070
  4. Evening primrose oil and forskolin decreased the prothrombotic effect of celecoxib initiated by a LPS challenge in mice, and this effect was, at least partly, mediated by mitigating TF expression and activity. PMID: 28124089
  5. There was no significant contribution of TF on myeloid cells in multiple models of experimental ALI, leading to the conclusion that TF in myeloid cells is not a major contributor to experimental ALI. PMID: 26924425
  6. Hepatocyte TF activates coagulation in a mouse model of chronic liver injury PMID: 26325534
  7. Thrombin-independent contribution of tissue factor to inflammation and cardiac hypertrophy in a mouse model of sickle cell disease. PMID: 26817955
  8. expression by myeloid cells affects macrophage differentiation, and regulate Mycobacterium tuberculosis growth PMID: 26471500
  9. TF expressed on tumor microparticles contributes to the increased incidence of cancer-associated venous thrombosis in mice in vivo. PMID: 25955268
  10. These findings reveal a novel biological function and mechanism of the protein C pathway in which protein S and the aPC-cleaved form of fV are cofactors for anti-inflammatory cell signaling by aPC in the context of endotoxemia and infection PMID: 26341257
  11. Lung epithelial tissue factor regulates alveolar procoagulant activity and permeability in acute lung injury. PMID: 25884207
  12. PGE2 increases both TF expression and activity through the regulation of the EP1/SIRT1 pathway. PMID: 26065856
  13. Fas-initiated, caspase-3-dependent hepatocyte apoptosis increases tissue factor procoagulant activity through a mechanism involving phosphatidylserine externalization. PMID: 25015658
  14. Heme promotes tissue factor-dependent coagulation activation and induces tissue factor expression on leukocytes in vivo. PMID: 25596265
  15. TF is essential for the development of pericyte coverage of tumor microvessels and aPL-induced tumor cell expression of chemokine ligand 2, a mediator of pericyte recruitment PMID: 25451155
  16. Alternatively spliced tissue factor promotes plaque angiogenesis through the activation of hypoxia-inducible factor-1alpha and vascular endothelial growth factor signaling. PMID: 25116956
  17. Klkb1(-/-) mice have a novel mechanism for thrombosis protection in addition to reduced contact activation. This pathway arises when bradykinin delivery to vasculature is compromised and mediated by increased receptor Mas, prostacyclin, Sirt1, and KLF4 PMID: 25339356
  18. study provides a novel mechanism for the posttranscriptional regulation of TF expression, indicating that this is selectively regulated by PARP-14. PMID: 25293769
  19. Mice in which TF gene is disrupted in the neuroectodermal lineage exhibit delayed progression of spontaneous brain tumors driven by oncogenic N-ras and SV40 large T antigen (SV40LT) expressed under the control of sleeping beauty transposase. PMID: 25450387
  20. Alternatively spliced tissue factor is not sufficient for embryonic development PMID: 24879059
  21. demonstrate that TLR-4 contributes to arterial thrombosis formation in vivo and causes increased TF expression and activity in vitro PMID: 25275013
  22. New insights into the spatiotemporal localization of prothrombinase in vivo. PMID: 24869936
  23. FVIIa binding to EPCR on the endothelium facilitates the transport of FVIIa from circulation to extravascular tissues where TF resides PMID: 22950420
  24. TF expression is regulated by JAK2-STAT3 signaling. PMID: 23238822
  25. TF expression plays a pivotal role in the pathogenesis of MPE generation via regulating of tumor metastasis and vascular permeability in lung adenocarcinoma bearing activated Stat3. PMID: 24086497
  26. Tissue factor expression provokes escape from tumor dormancy and leads to genomic alterations. PMID: 24520174
  27. endosomal signalling may represent a central coordinating point in the process of induction of TF expression PMID: 23328933
  28. Data indicate that hfVII-LC and hIgG1-Fc can effectively inhibit tumor growth and metastases in SCID mice with tissue factor (TF) over-expressing colon cancer. PMID: 23494077
  29. Tanshinone IIA inhibits cell proliferation and TF and MMP-12 expressions in RAW264.7 cells stimulated by ox-LDL. PMID: 19620042
  30. vascular Gas6 contributes to thrombus formation in vivo and can be explained by the ability of Gas6 to promote tissue factor expression and activity. PMID: 23149844
  31. PAK1 negatively regulates the expression of TFPI and additionally contributes to increased TF activity. PMID: 23038262
  32. TF expression by myeloid cells does not significantly contribute to venous thrombogenesis in an electrolytic injury model. PMID: 22192154
  33. Cyclooxygenase-2-derived prostacyclin regulates arterial thrombus formation by suppressing tissue factor in a sirtuin-1-dependent-manner. PMID: 22865892
  34. Authors propose that murine alternatively spliced tissue factor is a functional homolog of murine alternatively spliced tissue factor, exerting some of its key effects via beta3 integrins. PMID: 22481268
  35. Findings suggest a gene therapy for hemophilia A treatment using factor VIII (FVIII)-dual vectors. PMID: 22744182
  36. Our data indicate that different cellular sources of TF contribute to activation of coagulation, vascular inflammation, and endothelial cell injury in sickle cell disease. PMID: 22661702
  37. Only TF-positive cell lines activated coagulation in nude mice, and this activation was abolished by an anti-human TF Ab. PMID: 22547577
  38. alternatively spliced tissue factor (TF) and full-length TF protect cardiomyocytes against TNF-alpha-induced apoptosis via activation of specific signaling pathways, and up-regulation of anti-apoptotic members of the Bcl-2 protein family. PMID: 22326437
  39. Results suggest that the prothrombotic state associated with hypercholesterolemia is caused by oxLDL-mediated induction of tissue factor expression in monocytes via engagement of a TLR4/TLR6 complex. PMID: 22214850
  40. Data show that tissue factor plays a detrimental role in experimental colitis by signal transduction-dependent keratinocyte-derived chemokine production in colon, thereby provoking granulocyte influx with subsequent inflammation and organ damage. PMID: 21717035
  41. Findings implicate role for cAMP in regulation of the gene expression of tissue factor and plasminogen activator inhibitor-1 in adipocytes. PMID: 21496886
  42. soluble alternatively spliced (as)TF may serve as a migration- and angiogenesis-promoting factor PMID: 21389637
  43. RAR-a, RXR-a and TF may emerge as important regulatory molecules and play important role in liver injury. PMID: 21658367
  44. Smooth muscle cells may be the major source of TF in atherosclerosis without plaque rupture. PMID: 19662362
  45. TF gene and protein expression was significantly elevated in mice treated by allogenic hematopoietic stem cell transplantation. PMID: 19954621
  46. Upregulated tissue factor(TF) expression may be associated with age-related macular degeneration(AMD), and inflammatory and oxidative stress may contribute to TF expression in AMD eyes. PMID: 21042291
  47. This study identified tissue factor (TF) as a crucial mediator of fetal and placental damage in mouse models of recurrent miscarriages and preeclampsia. PMID: 21262438
  48. Sirt1 inhibition induces tissue factor expression and arterial thrombus formation in vivo. PMID: 20978007
  49. the TWEAK-Fn14 axis can regulate activation of TF and PAI-1 expression in vascular cells PMID: 20810696
  50. tissue factor expression contributes to exacerbated diabetic nephropathy in mice lacking eNOS fed a high fat diet PMID: 20626618

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Tissue factor family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*