Recombinant Oncorhynchus mykiss Transforming growth factor beta-1(TGFB1)

Code CSB-YP023446OEI
Product Type Recombinant Protein
Size US$2959
Uniprot No. O93449
Relevance Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Short name: TGF-beta-1
Species Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS
Research Area Signal Transduction
Source Yeast
Gene Names tgfb1
Protein Names Recommended name: Transforming growth factor beta-1 Short name= TGF-beta-1
Expression Region 271-382aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.
Subcellular Location Secreted
Protein Families TGF-beta family
Tissue Specificity Expressed in blood leucocytes, kidney macrophages, brain, gill and spleen but not in liver.
Database Links

UniGene: Omy.30069

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
Osteoclast differentiation
Th17 cell differentiation
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Related Products

tgfb1 Antibodies

tgfb1 Antibodies for Oncorhynchus mykiss

tgfb1 Proteins

tgfb1 Proteins for Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.