Recombinant Pan troglodytes Lymphotoxin-beta(LTB),partial

Code CSB-EP771253EQVa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q862Z7
Relevance Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3
Species Pan troglodytes (Chimpanzee)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Research Area Others
Source E.coli
Gene Names LTB
Expression Region 49-244aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 36.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface (By similarity).
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Tumor necrosis factor family
Database Links

KEGG: ptr:744486

STRING: 9598.ENSPTRP00000050396

UniGene: Ptr.6336

Pathway NF-kappa B signaling pathway

Related Products

LTB Antibodies

LTB Antibodies for Pan troglodytes (Chimpanzee)

LTB Proteins

LTB Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.