Recombinant Rabbit E-selectin (SELE),partial

Code CSB-YP020975RB
Product Type Recombinant Protein
Size US$2959
Uniprot No. P27113
Relevance Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62E
Species Oryctolagus cuniculus (Rabbit)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence WTYHFSAENMTYDEASAYCQQNYTHLVAIQNKEEIDYLNSILDYSPSYYWIGIRKVNNVWIWVGTHKPLTEGAKNWAPGEPNNKQNNEDCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSGHGECIETINNYSCKCYPGFSGLKCEQVVTCEAQVQPQHGSLNCTHPLGNFSYNSSCSVSCERGYLPSSTETTWCTSSGEWSAPPATCKVVECDTMGKPANGDVKCSPSQGSAPWNTTCTFDCEEGFTLLGARSLQCTSSGSWDNEKPTCKAVSCDTIHHPQNGSVSCSNSSEGKFTFRSSCNFTCEENFLLRGPAQVECTAQGQWTQQAPVCEAVKCDPVHTLEDGFVKCTHPHTGEFTYKSSCTFNCREGFELHGSAQLECTSQGQWAQELPSCQVVQCPSLAVLGKTNVSCSGEPVFGTVCNFACPEGWTLNGSAALMCGAEGQWSGMLPTCEEPIASNVP
Research Area Others
Source Yeast
Gene Names SELE
Protein Names Recommended name: E-selectin Alternative name(s): CD62 antigen-like family member E Endothelial leukocyte adhesion molecule 1 Short name= ELAM-1 Leukocyte-endothelial cell adhesion molecule 2 Short name= LECAM2 CD_antigen
Expression Region 24-495aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 53.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Selectin/LECAM family
Database Links

KEGG: ocu:100009151

UniGene: Ocu.1871

Pathway TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications

Related Products

SELE Proteins

SELE Proteins for Oryctolagus cuniculus (Rabbit)

SELE ELISA Kit

SELE ELISA Kit for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.