Recombinant Rat Beta-nerve growth factor(Ngf)

Code CSB-YP015779RA
Product Type Recombinant Protein
Size US$2474
Uniprot No. P25427
Relevance Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
Research Area Neuroscience
Source Yeast
Gene Names Ngf
Protein Names Recommended name: Beta-nerve growth factor Short name= Beta-NGF
Expression Region 122-241aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.
Subcellular Location Secreted
Protein Families NGF-beta family
Database Links

KEGG: rno:310738

STRING: 10116.ENSRNOP00000022200

UniGene: Rn.22168

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Ras signaling pathway
Rap1 signaling pathway
Inflammatory Pain
Inhibitors of axonal regeneration

Related Products

Ngf Antibodies

Ngf Antibodies for Rat

Ngf Proteins

Ngf Proteins for Rattus norvegicus (Rat)

Ngf ELISA Kit

Ngf ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.