Recombinant Rat Glucagon-like peptide 1 receptor (Glp1r), partial

In Stock
Code CSB-EP009514RA1
Abbreviation Recombinant Rat Glp1r protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
Glp1r; GlprGlucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
22-135aa
Target Protein Sequence
GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Gene References into Functions
  1. Our data indicates that activation of IGF-1R and/or the IR autocrine loops resulting in beta-cell protection and function, involve mechanisms independent to the enhanced metabolic effects resulting from sustained GLP-1R activation PMID: 29412813
  2. increased GLP-1R innervation in IBD bowel could mediate enhanced visceral afferent signalling, and provide a peripheral target for therapeutic intervention PMID: 29813107
  3. Study found GLP-1/GLP-1R signaling in the brainstem to be required for the central mediation of cancer anorexia-cachexia syndrome in hepatoma tumor-bearing rats. A blockade of brainstem GLP-1 not only attenuated anorexia, but also body weight loss and muscle wasting. PMID: 29247677
  4. Results show that lateral dorsal tegmental nucleus (LDTg) GLP-1R signaling is pharmacologically and physiologically relevant for LDTg tointegrate energy balance-relevant signals to modulate feeding and provide novel evidence of gut-nucleus tractus solitarius-LDTg GLP-1 signaling. PMID: 28920591
  5. Low GLP-1R expression is associated with intestinal ischemia/reperfusion injury. PMID: 30195035
  6. These findings indicate that sitagliptin treatment regulates GLP-1R and CB-1R gene expressions, which are associated with appetite regulation in diabetic rat, and may decrease oxidative stress and liver tissue damage. PMID: 28599244
  7. Nucleus tractus solitarius GLP-1R signaling is required for the control of food intake and motivation to feed. PMID: 27782127
  8. The findings of this study indicated that increased activation of NTS GLP-1-expressing neurons by corticosterone may represent a homeostatic response to cocaine taking, thereby reducing the reinforcing efficacy of cocaine. PMID: 26675243
  9. Exendin-4 treatment decreased MI size, suppressed chamber dilation, myocyte hypertrophy, and fibrosis and improved in vivo heart function in the rats subjected to MI. Exendin-4 resulted in an increase in circulating GLP-1 and GLP-1R in ventricular tissues PMID: 28242257
  10. The vasodilatation due to glucagon evokes via the glucagon-receptor, but also via the receptor for GLP-1, and it is endothelium-independent. PMID: 26975347
  11. Results suggest that geniposide pretreatment inhibits hypoxia/reoxygenation (H/R)-induced myocardial apoptosis by reversing mitochondrial dysfunction, an effect in part due to activation of GLP-1R and PI3K/AKT signaling pathway. PMID: 27372651
  12. Data show that GLP-1 receptor (GLP-1R) activation induced beta-catenin nuclear translocation in bone marrow stromal cells (BMSCs). PMID: 26947974
  13. Results strongly implicate the GLP-1R in mediating the unconditioned suppression of dopamine signaling by the emetic agent LiCl and support the GLP-1R as a target in the treatment of maladaptive aversive associations PMID: 26211731
  14. hindbrain GLP1 neurons in rats are equipped to store glutamate in synaptic vesicles, and likely co-release both glutamate and GLP1 from axon varicosities and terminals in the hypothalamus and other brain regions PMID: 25012114
  15. Glucagon-like peptide-1 receptor (GLP-1R) agonists reduce food intake and are approved by the Food and Drug Administration for the treatment of obesity, but the cellular mechanisms underlying the anorectic effects of GLP-1 require further investigation. PMID: 27013681
  16. The favorable preclinical data indicated that (18)F-Al-NOTA-MAL-Cys(39)-exendin-4may be suitable for non-invasive monitoring functional pancreatic beta cells. PMID: 26850848
  17. These results suggested that beta-cell GLP-1 receptor signaling involved activation of KATP channels via a PI3K-dependent pathway. PMID: 26655814
  18. Vagal afferent neuron knockdown of GLP1R increased meal size, accelerated gastric emptying, increased postprandial glycemia, and blunted insulin release. PMID: 26470787
  19. reduced GLP-1R expression in spontaneously hypertensive rat renal arteries most likely mediated through PKCbeta upregulation PMID: 25915883
  20. Cardioprotection Resulting from Glucagon-Like Peptide-1 Administration Involves Shifting Metabolic Substrate Utilization to Increase Energy Efficiency in the Rat Heart. PMID: 26098939
  21. Activation of the GLP-1 receptors in the nucleus of the solitary tract reduces food reward behavior and targets the mesolimbic system PMID: 25793511
  22. these data provide novel evidence that lipotoxicity decreases the mesangial GLP-1R expression in intact cells and in vivo. PMID: 26302449
  23. induced T1DM and T2DM may differently modulate GLP-1R system in enteropancreatic axis PMID: 25893200
  24. Results illuminate novel neuronal and behavioral mechanisms mediating food intake reduction by GLP-1 via GLP-1R activation in the ventral hippocampal formation PMID: 25035078
  25. Hyperglycemia decreases GLP-1R expression in retinal pigment epithelial cells. PMID: 25483438
  26. GLP-1 receptors are located in the renal vasculature, including afferent arterioles. Activation of these receptors reduces the autoregulatory response of afferent arterioles to acute pressure increases and increases RBF in normotensive rats. PMID: 25656368
  27. GLP-1 receptor agonist increased CTRP3 expression in visceral adipose tissue of type 2 diabetic rats. PMID: 25177707
  28. glucose lowering properties of acute administration of GLP-1R agonists are not accounted for by their central effects. PMID: 24879927
  29. The results demonstrate GLP-1 receptor regulation of hippocampal function and are consistent with GLP-1 receptor agonists enhancing GABAA signaling by pre- and postsynaptic mechanisms. PMID: 25114295
  30. results indicate that GLP-1-producing neurons in the nucleus tractus solitarius project monosynaptically to the lateral parabrachial nucleus, providing a potential endogenous mechanism by which lPBN GLP-1R signaling may exert effects on food intake control PMID: 24681814
  31. GLP-1R on POMC/CART-expressing ARC neurons likely mediates liraglutide-induced weight loss PMID: 25202980
  32. Food intake inhibitory effects of nucleus tractus solitarius GLP-1R signaling extend beyond satiation and include effects on food reward and motivation that are typically ascribed to midbrain and forebrain neurons. PMID: 24944243
  33. Data suggest that signaling involving Glp1/Glp1 receptor in hindbrain neurons (specifically area postrema) is involved in appetite regulation; analogs of GLP1 (agonists of Glp1 receptor) inhibit eating; antagonists of Glp1 receptor stimulate eating. PMID: 24601880
  34. Data suggest that responsiveness of pancreatic beta cells to glucose level resulting in secretion of insulin involves Glp1/Glp1r (glucagon-like peptide-1/glucagon-like peptide-1 receptor) signaling and GLP1/Glp1r agonists act as hypoglycemic agents. PMID: 24425760
  35. Studied GLP-1R occurrence in normal pancreas, acute pancreatitis (AP)/chronic pancreatitis (CP), and the effects of GLP-1 analog on normal PSCs, their ability to stimulate inflammatory mediator secretion or proliferation. PMID: 24217090
  36. Glucagon-like peptide 1 receptor induced suppression of food intake, and body weight is mediated by central IL-1 and IL-6. PMID: 24048027
  37. The presence of nutrients in the gut may be required for endogenous stimulation of nucleus accumbens GLP-1R. PMID: 23612998
  38. these results indicated that GLP-1 and GLP-1R are implicated in the pathogenesis of irritable bowel syndrome-C and irritable bowel syndrome-D. PMID: 23338623
  39. Glp1r activation attenuates high glucose-induced cardiomyocyte apoptosis in association with decreased ER stress and markers of enhanced SERCA2a activity PMID: 23302777
  40. GLP-1R expression is strongly up-regulated immediately after birth in neonatal rats, particular in male offspring. PMID: 23354098
  41. Pulmonary delivery of ROSE-010 inhibits gut motility through the GLP-1R similar to natural GLP-1. PMID: 22960405
  42. The effect of a GLP-1 receptor agonist on single-nephron glomerular filtration rate, proximal reabsorption, tubuloglomerular feedback responses and urine flow rate in hydropenic male Wistar and Wistar-Froemter rats is reported. PMID: 23019232
  43. in both mice and rats, peripheral GLP-1 reduces food intake significantly less than Ex-4, even when protected from DPP-4 PMID: 23033273
  44. Evolutionarily conserved residues at glucagon-like peptide-1 (GLP-1) receptor core confer ligand-induced receptor activation PMID: 22105074
  45. Blockade of endogenous GLP-1R signaling in the VTA and NAc core resulted in a significant increase in food intake, establishing a physiological relevance for GLP-1 signaling in the mesolimbic reward system. PMID: 22128031
  46. Glucagon-like peptide-1 receptor activation stimulates hepatic lipid oxidation and restores hepatic signalling alteration induced by a high-fat diet in nonalcoholic steatohepatitis. PMID: 21745271
  47. Endogenous GLP-1 receptor signaling is necessary for the reduction in food intake produced by jejunal linoleic acid infusions. PMID: 21917638
  48. these findings indicated that glucose fluctuation reduces GLP-1R expression through ER stress more profoundly than sustained hyperglycemia, which may contribute to the diminished response of GLP-1. PMID: 21945929
  49. Glucagon-like peptide 1 increases pancreatic insulin secretion by affecting brain stem vagal efferent pathways. PMID: 17322063
  50. GLP-1r are present on nerve terminals in hepatic portal bed, and GLP-1 antagonism localized to this region impairs glucose tolerance. These data are consistent with an important component of neural mediation of GLP-1 action. (GLP-1) PMID: 17584962

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Pancreatic islets, stomach, lung, rat insulinoma cell line.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*