Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Rat Pth1r at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 0.7384-1.203 ng/mL.

Target Names

Pth1r

Uniprot No.

P25961

Alternative Names

Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor (PTH/PTHr receptor); Parathyroid hormone 1 receptor (PTH1 receptor); Pth1r; Pthr, Pthr1

Species

Rattus norvegicus (Rat)

Source

Mammalian cell

Expression Region

27-188aa

Target Protein Sequence

DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLG

Mol. Weight

20.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

PTH1R mediates the skeletal and renal actions of parathyroid hormone and parathyroid hormone-related peptide, making its extracellular domain a critical target for understanding calcium homeostasis and bone remodeling pathways. This partial construct spans residues 27–188, capturing the N-terminal extracellular ligand-binding domain, and is expressed in mammalian cells to preserve the native glycosylation and disulfide bonding patterns essential for physiological receptor conformation. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 0.74–1.20 ng/mL, confirming that the folded domain retains epitopes recognized by therapeutic-grade antibodies and supports use in competitive inhibition assays, blocking antibody screening, and epitope mapping studies. Purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in ligand-binding assays, SPR-based affinity characterization, and small-molecule inhibitor screening campaigns targeting PTH1R signaling.

Target Background

Function

Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

Results show the expression of PTHrP and its receptor, PTHR1, in the majority of neurons and glial cells in the SCG of rats. Expression of PTHrP, but not PTHR1 in the cytoplasm of SCG neurons is influenced by ovarian activity. PMID: 25278090
Data indicate that PTH1R and PTHrP were more predominantly expressed in smooth muscle than in urothelium. PMID: 23546599
Vav2 specifically interacted with activated Galpha(q) but not with Galpha(s) subunits, competing with PTHR for coupling to Galpha(q). PMID: 22554804
Nicotine induces PTHrP expression in endothelial cells but excessive concentrations of nicotine reduce PTHrP receptor expression thereby attenuating any protective effects of PTHrP against apoptosis. PMID: 22508055
Dynamic Na+-H+ exchanger regulatory factor-1 association and dissociation regulate parathyroid hormone receptor trafficking at membrane microdomains PMID: 21832055
This study demonstrates the dynamic expression of EBP50 in vessels following injury and the effects of EBP50 on PTH1R function in vascular smooth muscle cells. PMID: 20843475
These findings suggest that FGFR3 down-regulates PTH/PTHrP receptor gene expression via the JAK/STAT signaling in chondrocytic cells. PMID: 20356821
Downregulation of PTHrP and PTHrP-R gene expression during late lung morphogenesis may cause pulmonary hypoplasia in the nitrofen CDH model, disrupting alveolar maturation and surfactant production by interfering with mesenchymal-epithelial interactions. PMID: 19855984
The impaired secretory capacity of the parathyroid glands in uremic rats is significantly enhanced by PTHrP. An autocrine/paracrine role in the parathyroid glands of the PTH/PTHrP receptor targeting peptides, PTHrP and PTH, is suggested. PMID: 12787396
a high P diet with subsequent decrease in serum Ca concentration suppressed the PTH action in the kidney due to PTH/PTHrP receptor mRNA down-regulation PMID: 15618618
An examination of parathyroid hormone-related peptide (PTHrP) receptor mRNA expression in 6-week-old parathyroidectomized rats. PMID: 15630249
findings show the calpain small subunit binds to the N-terminal portion of PTH1R's intracellular tail; calpain hydrolyzes the C-tail of PTH1R in a Ca2+- and ligand-dependent manner; the absence and reduction of calpain activity affect PTH1R signaling PMID: 15691895
PTH1R forms a complex with the transport regulatory proteins, importin alpha(1) and importin beta, and nuclear PTH1R is associated with the nucleoplasm PMID: 16574786
parathyroid hormone-related peptide, by interaction with the PTH1 receptor, can increase tubulointerstitial cell survival and seems to act as a proinflammatory and profibrogenic factor in the FA-damaged kidney PMID: 16672315
data demonstrate that angiotensin II acts via the angiotensin II type 1 receptor to destabilize parathyroid hormone receptor 1(PTH1R) mRNA in the renal vessel in the spontaneously hypertensive rats model of genetic hypertension PMID: 16728497
osteoblast PTH1R expression down-regulated at both the protein and mRNA levels in the steady state of chronic renal failure PMID: 17384996
Nuclear Localization Signal at residues 471-488 of the mature rat PTH1R is functional and plays a role in targeting the PTH1R the nucleus PMID: 17627912
Results conclude that PTH and PTHrP bind similarly to the G protein-coupled PTHR conformation, PTH has a greater capacity to bind to the G protein-uncoupled conformation. PMID: 17872377
Studies proposed that, in ROS cells, the presence of NHERF1 induces PTH-dependent calcium signaling by a cAMP-mediated mechanism that involves local protein kinase A-dependent activation of calcium channels. PMID: 18202147
PTH signaling to PLC is negatively regulated by PTH/PTHrP receptor phosphorylation and PKA. PMID: 18450967
Defective transport of mutant PTH receptor(Pro132Leu) to the experimental cell surface indicate a molecular basis for Blomstrand's chondrodysplasia. PMID: 18480546
The regulation of PTH1R expression by endogenous PTHrP and the associated effects on vascular smooth muscle cell proliferation, was investigated. PMID: 19574446

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Database Links

KEGG: rno:56813

STRING: 10116.ENSRNOP00000028435

UniGene: Rn.48025

Code	CSB-MP018988RA2
Abbreviation	Recombinant Rat Pth1r protein, partial (Active)
MSDS	MSDS Datasheet
Size	$98
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Rat Pth1r at 2 μg/ml can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC₅₀ is 0.7384-1.203 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage