Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial

In Stock
Code CSB-YP018988RA2
Abbreviation Recombinant Rat Pth1r protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
PTH/PTHrP type I receptor;PTH/PTHr receptor;Parathyroid hormone 1 receptor;PTH1 receptor
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
27-188aa
Target Protein Sequence
DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Results show the expression of PTHrP and its receptor, PTHR1, in the majority of neurons and glial cells in the SCG of rats. Expression of PTHrP, but not PTHR1 in the cytoplasm of SCG neurons is influenced by ovarian activity. PMID: 25278090
  2. Data indicate that PTH1R and PTHrP were more predominantly expressed in smooth muscle than in urothelium. PMID: 23546599
  3. Vav2 specifically interacted with activated Galpha(q) but not with Galpha(s) subunits, competing with PTHR for coupling to Galpha(q). PMID: 22554804
  4. Nicotine induces PTHrP expression in endothelial cells but excessive concentrations of nicotine reduce PTHrP receptor expression thereby attenuating any protective effects of PTHrP against apoptosis. PMID: 22508055
  5. Dynamic Na+-H+ exchanger regulatory factor-1 association and dissociation regulate parathyroid hormone receptor trafficking at membrane microdomains PMID: 21832055
  6. This study demonstrates the dynamic expression of EBP50 in vessels following injury and the effects of EBP50 on PTH1R function in vascular smooth muscle cells. PMID: 20843475
  7. These findings suggest that FGFR3 down-regulates PTH/PTHrP receptor gene expression via the JAK/STAT signaling in chondrocytic cells. PMID: 20356821
  8. Downregulation of PTHrP and PTHrP-R gene expression during late lung morphogenesis may cause pulmonary hypoplasia in the nitrofen CDH model, disrupting alveolar maturation and surfactant production by interfering with mesenchymal-epithelial interactions. PMID: 19855984
  9. The impaired secretory capacity of the parathyroid glands in uremic rats is significantly enhanced by PTHrP. An autocrine/paracrine role in the parathyroid glands of the PTH/PTHrP receptor targeting peptides, PTHrP and PTH, is suggested. PMID: 12787396
  10. a high P diet with subsequent decrease in serum Ca concentration suppressed the PTH action in the kidney due to PTH/PTHrP receptor mRNA down-regulation PMID: 15618618
  11. An examination of parathyroid hormone-related peptide (PTHrP) receptor mRNA expression in 6-week-old parathyroidectomized rats. PMID: 15630249
  12. findings show the calpain small subunit binds to the N-terminal portion of PTH1R's intracellular tail; calpain hydrolyzes the C-tail of PTH1R in a Ca2+- and ligand-dependent manner; the absence and reduction of calpain activity affect PTH1R signaling PMID: 15691895
  13. PTH1R forms a complex with the transport regulatory proteins, importin alpha(1) and importin beta, and nuclear PTH1R is associated with the nucleoplasm PMID: 16574786
  14. parathyroid hormone-related peptide, by interaction with the PTH1 receptor, can increase tubulointerstitial cell survival and seems to act as a proinflammatory and profibrogenic factor in the FA-damaged kidney PMID: 16672315
  15. data demonstrate that angiotensin II acts via the angiotensin II type 1 receptor to destabilize parathyroid hormone receptor 1(PTH1R) mRNA in the renal vessel in the spontaneously hypertensive rats model of genetic hypertension PMID: 16728497
  16. osteoblast PTH1R expression down-regulated at both the protein and mRNA levels in the steady state of chronic renal failure PMID: 17384996
  17. Nuclear Localization Signal at residues 471-488 of the mature rat PTH1R is functional and plays a role in targeting the PTH1R the nucleus PMID: 17627912
  18. Results conclude that PTH and PTHrP bind similarly to the G protein-coupled PTHR conformation, PTH has a greater capacity to bind to the G protein-uncoupled conformation. PMID: 17872377
  19. Studies proposed that, in ROS cells, the presence of NHERF1 induces PTH-dependent calcium signaling by a cAMP-mediated mechanism that involves local protein kinase A-dependent activation of calcium channels. PMID: 18202147
  20. PTH signaling to PLC is negatively regulated by PTH/PTHrP receptor phosphorylation and PKA. PMID: 18450967
  21. Defective transport of mutant PTH receptor(Pro132Leu) to the experimental cell surface indicate a molecular basis for Blomstrand's chondrodysplasia. PMID: 18480546
  22. The regulation of PTH1R expression by endogenous PTHrP and the associated effects on vascular smooth muscle cell proliferation, was investigated. PMID: 19574446

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*