Recombinant Rat Protein S100-A4(S100a4)

In Stock
Code CSB-EP020632RA
Size US$388
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020632RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP020632RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) S100a4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
S100a4
Uniprot No.
Research Area
Cardiovascular
Alternative Names
S100a4; Protein S100-A4; Metastasin; Nerve growth factor-induced protein 42A; P9K; Placental calcium-binding protein; S100 calcium-binding protein A4
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
2-101aa
Target Protein Sequence
ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
18.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9. Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis. Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels. Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes. In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors.
Gene References into Functions
  1. Data indicate that microRNA miR-124 targets S100 calcium-binding protein A4 (S100A4) 3' UTR and regulates vascular smooth muscle cell proliferation. PMID: 28235243
  2. S100A4 is upregulated in the experimental rat periodontitis. PMID: 26499072
  3. Results show S100A4 expression increasing during fibrotic stage and declining during resolution suggesting it as a good marker for liver fibrogenesis. PMID: 26721462
  4. found a significant increase in the expression of S100A4 in vitreous samples of rats with diabetic retinopathy PMID: 25253987
  5. TG2 regulates S100A4-mediated mammary tumor cell migration. PMID: 23469180
  6. S100A4 modulates p53 function in fibroblasts and thereby mediates myocardial interstitial fibrosis through two distinct mechanisms; cell proliferation and collagen expression. PMID: 23352991
  7. The concentration gradient of S100A4 induces direction guidance for neurons and astrocytes. PMID: 23222508
  8. S100A4 downregulates filopodia formation through increased dynamic instability PMID: 21975553
  9. The presence of S100A4 in sensory neurons, including their processes in the central nervous system, suggests that S100A4 is involved in propagation of sensory impulses in specific fiber types. PMID: 15101091
  10. results indicated that S100A4 may play a role as a possible target molecule for TCR gamma delta T cell-mediated lysis although how S100A4 is involved in TCR gamma delta T cell-mediated lysis remains to be determined PMID: 15665453
  11. the ability to interact with protein target(s) is important in S100A4-induced metastasis PMID: 15856021
  12. S100A4 has a stabilizing function in reactive white matter astrocytes PMID: 16265672
  13. high-grade glioblastomas express higher amount of S100A4/Mts1 than low-grade astrocytic tumors PMID: 17223348

Show More

Hide All

Subcellular Location
Secreted. Nucleus. Cytoplasm.
Protein Families
S-100 family
Database Links

KEGG: rno:24615

STRING: 10116.ENSRNOP00000015958

UniGene: Rn.504

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Leave a message

check code
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1