Recombinant Rat Protein-lysine 6-oxidase (Lox)

In Stock
Code CSB-EP013038RA
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Lox
Uniprot No.
Research Area
Others
Alternative Names
LoxProtein-lysine 6-oxidase; EC 1.4.3.13; Lysyl oxidase) [Cleaved into: Protein-lysine 6-oxidase; long form; Protein-lysine 6-oxidase; short form]
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
163-411aa
Target Protein Sequence
DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
33.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Gene References into Functions
  1. data suggest a detrimental role for the chronic increase of cardiac LOX expression and activity in the transition from compensated remodeling to decompensated failure. PMID: 28668305
  2. Together, these findings suggest that bone fragility in DM2 is initiated in the matrix phase and that the LOX family may play a critical part in the pathogenesis of DM2 mediated bone fragility. PMID: 29146187
  3. Here we show that orthotopic implantation of rat prostate AT-1 tumour cells increased LOX and LOXLs mRNA expressions in the tumour and in the surrounding non-malignant prostate tissue PMID: 26804196
  4. The reduction of leptin levels by BAPN in vivo and the ability of this compound to inhibit leptin-induced profibrotic mediators and ROS production in cardiac and vascular cells suggest that interactions between leptin and LOX regulate downstream events responsible for myocardial and vascular fibrosis in obesity. PMID: 26780438
  5. LOX can promote the progress of epithelial-to-mesenchymal transition in a rat model of pulmonary fibrosis. PMID: 26670953
  6. In transgenic mice expressing rat LOX in wild-type megakaryocytes and platelets, higher affinity of Pf4-Lox(tg/tg) platelets to the collagen sequence GFOGER implies that the collagen receptor integrin alpha2beta1 is affected by LOX. PMID: 26755713
  7. Silenced lysyl oxidase expression results the growth of C3H10T1/2 cells by 50%, and blocked osteoblast differentiation. PMID: 24971753
  8. Decreased lox expression in diaphragmatic development and lung branching morphogenesis may contribute to the diaphragmatic defect and impaired airway formation in the nitrofen-induced congenital diaphragmatic hernia model. PMID: 25111273
  9. Results indicate that polyphenols bind to monomeric tropoelastin and enhance coacervation, aid in crosslinking of elastin by increasing lysyl oxidase (LOX) synthesis, and by blocking MMP-2 activity. PMID: 24440697
  10. Study supports a novel mechanism of n-acetylcysteine alleviating idiopathic pulmonary fibrosis by inhibition of LOX activity in a rat model. Time course of LOX activity during bleomycin-induced pulmonary fibrosis was also examined. PMID: 23006535
  11. These results suggest that in an indirect co-culture system, pelvic ligament fibroblasts with mechanical stretch stimulation can promote bone mesenchymal stem cell differentiation, reflecting in the increased expression of elastin, LOX, and Fibulin-5. PMID: 22205540
  12. These findings indicate that TNF-alpha stimulated LOX expression may play an important role in progressive cardiac fibrosis. PMID: 21893029
  13. In cardiac fibroblasts, Rac1 GTPase mediates upregulation of fibronectin via LOX and CTGF. PMID: 21215756
  14. The data presented herein regarding chromatin remodeling indirectly support the hypothesis that LOX binds to histone H1 in vivo. PMID: 20888776
  15. LOX were overexpressed in late stages of intimal hyperplasia in the allografts PMID: 20606470
  16. Suggest that uric acid increases fibronectin synthesis both in vivo and in vitro via urate transporters through upregulation of lysyl oxidase expression. PMID: 20484295
  17. lysyl oxidase propeptide contains both N- and O-linked carbohydrates; its structure is a mostly disordered protein PMID: 20192271
  18. Data indicate that lysyl oxidase propeptide (LOX-PP) inhibits terminal mineralization in primary calvaria osteoblast cultures when added at early stages of differentiation, with no effects seen when present at later stages. PMID: 20048148
  19. a PKC-MEK-MAPK-dependent pathway is critical to the enhanced expression of the LO gene PMID: 11968017
  20. findings indicate control of lysyl oxidase at endocrine, paracrine, and autocrine levels within the ovary and suggest coordinated regulation of ovarian extracellular matrix during follicular development PMID: 12488341
  21. comparison and aa sequence alignment of human and rat lysyl oxidase and lysyl oxidase-like gene (LOXL1); role in formation and repair of ECM elastin and collagen PMID: 12577300
  22. Beta-catenin transformation pathway is activated by lysyl oxidase down-regulation. PMID: 12686140
  23. The results showed that LOX was expressed in the choroid plexus, blood vessel walls, brain matrix, and neurons of normal rat. PMID: 14741400
  24. Upregulation by cigarette smoke condensate(CSC) of cellular thiols may play an important role in the downregulation of lysyl oxidase and subsequently destabilization of the lung ECM in CS-induced emphysema. PMID: 15509664
  25. Downregulation of LO is linked with upregulation of other Cu-binding proteins and with alteration in Cu homeostasis in the cadmium resistant lung fibroblasts. PMID: 17584760
  26. These novel data suggest that LOX-PP may provide a feedback control mechanism that serves to inhibit properties associated with the development of vascular pathology. PMID: 18060869
  27. spatial and temporal expression of LOX and LOXL1 during growth and aging in the aorta and specific roles for LOX and LOXL1 in the synthesis and remodeling of elastic and collagen fibers PMID: 18803461

Show More

Hide All

Subcellular Location
Secreted. Secreted, extracellular space.
Protein Families
Lysyl oxidase family
Tissue Specificity
Aorta and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*