Recombinant Rat Sterol regulatory element-binding protein 1 (Srebf1), partial

Code CSB-YP022657RA1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022657RA1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022657RA1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022657RA1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022657RA1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Srebf1; Srebp1; Sterol regulatory element-binding protein 1; SREBP-1; Adipocyte determination- and differentiation-dependent factor 1; ADD1; Sterol regulatory element-binding transcription factor 1
Species
Rattus norvegicus (Rat)
Expression Region
227-487aa
Target Protein Sequence
QQVPVVLQPHFIKADSLLLTAVKTDTGATMKTAGINTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIHRLAAGGKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVG TEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSLGSRGSSSGGSDSEPDSPAFEDNQVKAQRLP SHSRGMLDRSRLALCVLVFLC
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis.; Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis and lipid homeostasis. Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3'). Regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation.; Isoform expressed only in select tissues, which has higher transcriptional activity compared to SREBP-1C. Able to stimulate both lipogenic and cholesterogenic gene expression. Has a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver. Required for innate immune response in macrophages by regulating lipid metabolism.; Predominant isoform expressed in most tissues, which has weaker transcriptional activity compared to isoform SREBP-1A. Primarily controls expression of lipogenic gene. Strongly activates global lipid synthesis in rapidly growing cells.
Gene References into Functions
  1. SREBP1c and SREBP2 are transcriptional regulators of the thyroglobulin gene in thyroid cells. PMID: 27321819
  2. PPAR-alpha inhibitor (Blueberry Juice and Probiotics) increased the level of SREBP-1c and PNPLA-3 and prevents nonalcoholic steatohepatitis progression by affecting SREBP-1c/PNPLA-3 pathway via PPAR-alpha. PMID: 28264426
  3. The involvement of SREBP-1c in FASN promoter histone modification. PMID: 28027934
  4. GSK-3-mediated phosphorylation of serine 73 in the rat SREBP-1c and its concomitant destabilization represents a novel mechanism involved in the inhibition of de novo lipid synthesis in the liver. PMID: 26589965
  5. Betahistine could act on hepatic H1 receptors via modulation of AMPKalpha-SREBP-1. PMID: 26218603
  6. a novel regulatory mechanism by which n-3 PUFA inhibit induction of SREBP-1c by insulin. PMID: 26327595
  7. Gene expression studies show Srebf-1c was increased in the mammary gland, liver and adipose tissue of rats fed a low-lipid diet compared with rats from the adequate-lipid diet group throughout pregnancy and lactation. PMID: 25046614
  8. The V-shaped chronological alterations in white adipose tissue (WAT) are regulated via SREBP1c, which is probably activated by CR duration-dependent modulation of both insulin and leptin signaling. PMID: 25616173
  9. Angiotensin II-induced activation of SREBP-1 required signaling through the angiotensin II type I receptor and activation of PI3K/Akt in addition to the chaperone SCAP and protease S1P. PMID: 25398788
  10. SREBP-1c activation participates in skeletal muscle insulin resistance through a direct effect of suppressing Irs-1 transcription. PMID: 24362725
  11. Maternal fructose intake during pregnancy causes maternal hyperglycemia and up-regulates hepatic SREBP-1c expression in both fetuses and dams. PMID: 23065593
  12. Raising plasma insulin to postprandial levels, increased SREBP-1 mRNA comparably in livers and epidydimal adipose tissue of alert, free moving rats and in adipose tissue of human subjects. PMID: 23913732
  13. We demonstrated that H2O2-increase in SREBP-1 protein content was due to enhancement of SREBP-1a mRNA translation. PMID: 23583293
  14. SREBPs are novel transcriptional regulators of NIS. PMID: 23542164
  15. Treatment of diabetic rats with curcumin increased the phosphorylation of AMPK and prevented the increased renal expression of SREBP-1c. PMID: 22898567
  16. CR-associated remodeling of WAT, which involves SREBP-1-mediated transcriptional activation and suppression of macrophage infiltration, is regulated in a GH-IGF-1-independent manner. PMID: 22645024
  17. the effect of leptin-induced Stat3 pathway on SREBP-1c expression in HSCs might contribute to the role of leptin in liver fibrosis in mouse, thus advancing understanding of the mechanisms of liver fibrogenesis associated with leptin. PMID: 23295202
  18. Our results indicate that exendin-4 inhibits the activation of SREBP1c and C/EBPbeta, which, in turn, may reduce glucolipotoxicity-induced ER stress and beta-cell apoptosis. PMID: 23257266
  19. The elevated hepatic expression of Raldh1 in Zucker fatty (obese) rats may cause the excessive retinoic acid production from retinol, and in turn, result in higher Srebp-1c expression. PMID: 23028851
  20. FoxO1 inhibits SREBP-1c transcription via combined actions on multiple transcription factors and that this effect is exerted at least in part through reduced transcriptional activity of Sp1 and SREBP-1c PMID: 22511764
  21. Data reveal that aberrant activation of LXR reproduced the phenomenon of beta cell dysfunction in the development of type 2 diabetes. Upregulation of SREBP1c production and the lipotoxicity mediated by it played a central role in this process. PMID: 22415588
  22. EGR1 upregulation paralleled the expression and transcriptional activity of SREBP1c in long-term ethanol-fed Long-Evans rats. PMID: 22292946
  23. SREBP1 expression was elevated in type 2 diabetic rats. Early insulin therapy reduced SREBP1 expression. PMID: 22093779
  24. Data show that orotic acid induces hepatic lipogenesis, mediated predominantly by the AMPK/SREBP-1 pathway in rat hepatocytes and human hepatoma cell lines. PMID: 21757781
  25. High sterol regulatory element binding protein-1c is associated with the pathogenesis of non-alcoholic steatohepatitis. PMID: 21986124
  26. The mRNA levels of one insulin-induced (Srebp-1c) and one insulin-suppressed (Pck1) genes in response to insulin, glucagon, and compactin treatments in hepatocytes were analyzed. PMID: 21731709
  27. The expression of GLUT4 in response to insulin and fasting/refeeding in adipose tissue and the role of sterol regulatory binding protein-1c (SREBP-1c) in GLUT4 regulation are reported. PMID: 16787385
  28. Orotic acid caused fatty infiltration by stimulating TG synthesis through the upregulation of SREBP-1c and its target gene involved in fatty acid biosynthesis. PMID: 21167679
  29. SREBP-1c and Wnt10b display inverse expression patterns during muscle ontogenesis and regeneration, as well as during satellite cells differentiation.[SREBP-1c] PMID: 20041157
  30. Increased expression of SREBP-1 was further observed in the liver tissues of aging Fischer 344 rats. PMID: 20615871
  31. The oxidative stress and nonalcoholic fatty liver disease via SREBP-1c. PMID: 19616615
  32. role in regulating renal lipid metabolism and glomerulosclerosis in diabetes mellitus (SREBP-1) PMID: 11875060
  33. plays a role in the induction of lipogenic enzyme genes in response to insulin treatment PMID: 12016216
  34. results suggest that the IRS-1-PI 3-kinase pathway is essential for insulin-induced expression of SREBP-1c and glucokinase genes. PMID: 12031952
  35. SREBP-1c expression is sensitive to insulin and can transduce the positive and negative actions of the hormone on specific genes and thus has a pivotal role in long-term muscle insulin sensitivity. PMID: 12031958
  36. data indicate that PUFA suppress the in vivo proteolytic release of sterol regulatory element binding proteins-1 and -2, but the effect on SREBP-2 is transitory PMID: 12421847
  37. sterol regulatory element binding protein-1c maturation could be implicated in the pathogenesis of beta-cell glucolipotoxicity PMID: 12600983
  38. study provides evidence that acetyl-CoA carboxylase beta expression in liver is regulated at the transcriptional level by the direct interaction of sterol regulatory element binding protein-1 with promoter II PMID: 12764144
  39. SREBP-1c RNA and SREBP-1 protein levels respond to nutritional status in skeletal muscle. PMID: 12771318
  40. SREBP1c has a role in regulating lipogenic enzymes and transport proteins stimulated by keratinocyte growth factor in type II alveolar cells PMID: 12865412
  41. Results describe the temporal relationships and role of CCAAT/enhancing-binding protein alpha, sterol regulatory element binding protein-1c, and stearoyl-CoA desaturase 1 in lipogenesis in fetal rat lung. PMID: 12896875
  42. sterol regulatory element-binding protein-1 gene expression has a role in hepatic lipogenesis with Protein-tyrosine phosphatase 1B PMID: 12941932
  43. Protein kinase B has a role in insulin-dependent induction of sterol regulatory element-binding protein 1 mRNA in hepatocytes PMID: 14505487
  44. Sterol regulatory element-binding protein 1 (SREBR-1) plays a role in increase of the lipogenic potential of adipose tissue after repeated dieting. PMID: 14668913
  45. SREBP-1c is not altered when a modest hepatic overexpression of glucokinase alters expression of metabolic genes PMID: 14674713
  46. SREBP-1c and Sp1 interact to regulate transcription of the gene for phosphoenolpyruvate carboxykinase (GTP) in the liver PMID: 14744869
  47. Rats fed soy protein had an elevated hepatic SREBP1 mRNA level and avoided the developomenet of fatty liver. PMID: 14988441
  48. skeletal muscle SREBP-1c gene expression is regulated by nutritional status in a fashion similar to that observed in liver and adipose tissue PMID: 15001432
  49. ADD1/SREBP1c controls adiponectin gene expression in differentiated adipocytes PMID: 15037635
  50. SREBP-1c is stimulated by glucose through a Jak/STAT dependent pathway and has a role in intramuscular lipid accumulation associated with muscle insulin resistance PMID: 15039461

Show More

Hide All

Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.
Protein Families
SREBP family
Tissue Specificity
Expressed predominantly in brown adipose tissue.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1