Recombinant Rat Suppressor of cytokine signaling 3 (Socs3)

Code CSB-EP022392RA
Abbreviation Recombinant Rat Socs3 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Socs3; Cish3Suppressor of cytokine signaling 3; SOCS-3; Cytokine-inducible SH2 protein 3
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-225aa
Target Protein Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including IL6ST/gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity and regulates IL6 signaling. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Gene References into Functions
  1. These results suggest that SOCS3 might be a key molecular involved in the development of complicated cancer pain and that overexpression of SOCS3 might be an important strategy for treatment for mechanical allodynia associated with bone cancer. PMID: 28326931
  2. SOCS3 induces neurite differentiation and promotes neuronal cell survival.SOCS3-induced neurite differentiation was mediated via the PI3 kinase pathway. PMID: 27118613
  3. Using cultured primary neurons, JEV efficiently replicated in embryonic neurons rather than adult neurons, and the preference was accompanied by higher SOCS3 expression and protein tyrosine phosphatase activity. PMID: 28111888
  4. results suggest that knocking down of SOCS3 enhances dendritic regeneration and prevents demyelination after SCI PMID: 26384335
  5. alveolar macrophages can secrete SOCS1 and -3 in exosomes and microparticles, respectively, for uptake by alveolar epithelial cells and subsequent inhibition of STAT activation. PMID: 25847945
  6. SOCS-3 expression levels increased rapidly within 12 h after SAH, more slowly after 12 h, and did not reach a peak within 48 h. SOCS-3 was involved in cerebral vasospasm after subarachnoid hemorrhage via an IL-6- and IL-10-related mechanism. PMID: 24463741
  7. The TNF/SOCS3 pathways work through insulin receptor resistance to trigger apoptosis. PMID: 25086044
  8. The results of study suggest that the STAT3/SOCS3 signaling pathway plays an important role in regulating neuronal death after spinal cord injury. PMID: 24959867
  9. Data in vitro indicate that suppressor of cytokine signaling 3 (SOCS3) may play a negatively regulatory role in development and progression of vein graft failure. PMID: 24142708
  10. SOCS3 is a crucial physiological negative regulator for vein graft failure. PMID: 24685947
  11. SOCS3 expression accompanied the severity of inflammation and the expression of proinflammatory cytokines, as well as the activation status of STAT3 and p38 MAPK PMID: 24078776
  12. SOCS3-induced pro-inflammatory effects were due, at least in part, to its role in controlling activation and nuclear accumulation of nuclear factor-kappaB and activity of phosphatidylinositol 3-kinase. PMID: 24088176
  13. Prolactin stimulates normal liver growth, promotes survival, and regulates liver regeneration by mechanisms that may include hepatic downregulation of IL-6 and upregulation of SOCS-3, increased hepatocyte proliferation, and angiogenesis. PMID: 23948778
  14. IL-1b alone did not significantly increase SOCS-3 levels but when coincubated with insulin, prevented the downregulation of SOCS-3 expression. XOMA 052 neutralized the antagonistic effect of IL-1b on insulin-induced downregulation of SOCS-3. PMID: 23401297
  15. The expressions of C/EBPalpha and PPARgamma were significantly reduced after gene silencing of SOCS-1 or SOCS-3 in adipocytes. PMID: 23222907
  16. Vagal afferent neurons of diet-induced obese rats become leptin resistant; LPS and SOCS-3 may play a role in the development of leptin resistance. PMID: 21521717
  17. Data suggest that down-regulation of SOCS-1 and SOCS-3 ameliorates the capacity of glucose transport and provides a potential gene therapy approach to managing metabolic syndrome. PMID: 21364493
  18. With respect to neurite outgrowth SOCS3 alone is (as expected) strongly inhibitory, but it can also enhance the growth-promoting activity of mitogen-activated protein kinase 8 interacting protein 1 (JIP1). PMID: 20816823
  19. Chronic central leptin infusion increases the association of insulin receptor with SOCS3. PMID: 21255014
  20. Our data demonstrate the negative impact of enhanced SOCS3 expression on the regenerative potential of mature central nervous system neurons. PMID: 21145973
  21. postnatal overnutrition induced higher SOCS3 expression in adult animals,indicating central leptin resistance in adulthood. PMID: 20303731
  22. SOCS-3 knockdown may have increased the leptin-mediated in situ fatty acid oxidation in the DIO adipocytes, and therefore, SOCS-3 might be an excellent target for therapeutic intervention for obesity. PMID: 19862646
  23. AngII response in spontaneouly hypertensive rats associated with increased hypothalamic JAK-2/SOCS-3 expression may suggest that abnormal regulation of the central angiotensin pathways may contribute to dysfunction of water-electrolyte homeostasis. PMID: 20848345
  24. role of SOCS3 expressed in the mediobasal hypothalamus (MBH) in development of diet-induced obesity; data suggest knockdown of Socs3 mRNA limited to the MBH increases Npy mRNA levels, which decreases locomotor activity and alters feeding patterns PMID: 20819948
  25. SOCS3 of retina may play an important role in mitigating pathogenic effects of proinflammatory cytokines during different stages of experimental autoimmune uveoretinitis. PMID: 19176113
  26. High leptin concentration could induce the expressions of SOCS-3 mRNA and protein in mature adipocytes. PMID: 19408656
  27. SOCS3 knock-down does not influence the growth and adipogenic differentiation feature of adipose-derived stromal cells. PMID: 19693688
  28. Noradrenaline acting at central beta-adrenoceptors induces Socs3 expression in rat brain. PMID: 20193756
  29. increased expression in diabetes PMID: 20185635
  30. Results suggest that SOCS-3 may be a mediator of hypothalamic leptin resistance in aged rats, and that increased SOCS-3 expression may be due to age-related hyperleptinemia. PMID: 12163036
  31. Antisense knockdown of ischemia-induced SOCS-3 protein expression exacerbated transient MCAO-induced infarct volume, assigning a neuroprotective role to SOCS-3 PMID: 12437578
  32. induced by Ang II in rat heart and neonatal rat ventricular myocytes and participates in the modulation of the signal generated by this hormone PMID: 12960061
  33. SOCS-3 exhibits a rapid, robust, and transient induction in hippocampus after seizure, first in glia, followed by a robust induction in pyramidal and granule neurons, peaking at approximately 24 hr. PMID: 14614901
  34. SOCS-3 participates, as a late event, in the negative cross-talk between angiotensin II and insulin, producing an inhibitory effect on insulin-induced glucose transporter-4 translocation. PMID: 15514089
  35. Cross-talk between the SOCS/interferon and the IL-1beta pathways of signalling in pancreatic beta cells. PMID: 15578154
  36. Socs3 overexpression leads to neuroblastoma cell death and, on the other hand, leads to primary cell differentiation, indicating the involvement of SOCS-3 in neuronal cell survival and differentiation. PMID: 15998644
  37. Promoter deletion analysis revealed that the STAT response element (SRE) in the SOCS3 promoter is necessary for the promoter activity. PMID: 16300827
  38. involvement of SOCS3 in a direct gene regulatory pathway downstream of leptin-activated JAK-STAT signaling in pancreatic beta-cells PMID: 16306356
  39. These data suggest that training-induced elevations in SOCS-3 expression in skeletal muscle may contribute to the exercise-induced increase in IL-6 expression. PMID: 16484300
  40. Leptin induced SOCS-3 expression and its association with the insulin receptor in rat skeletal muscle cells but functional significance of this increase was not apparent upon measuring glucose uptake. PMID: 17223256
  41. SOCS-3 might have a defensive role in H. pylori-infected gastric mucosal cells PMID: 17405912
  42. increased glomerular IL-4 in nephrotoxic nephritis inhibits infiltrating macrophages from expressing SOCS3 and was associated with attenuated glomerular injury PMID: 18424750
  43. These results demonstrate SOCS-3 induction occurs in reactive astrocytes of the post-ischemic hippocampus, suggesting that SOCS-3 is involved in regulating the astroglial reaction to an ischemic insult. PMID: 18586073
  44. The up-regulation of SOCS1 and SOCS3 gene expression may be one of the possible mechanisms responsible for endotoxin tolerance. PMID: 19080716
  45. The objective of this study was to investigate the effect of SOCS-3 on TNFalpha-induced signalling in beta cells. PMID: 19643162

Show More

Hide All

Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*