Recombinant Rat Vascular endothelial growth factor A (Vegfa)

In Stock
Code CSB-EP025833RA
Abbreviation Recombinant Rat Vegfa protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Vegfa; Vegf; Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
27-214aa
Target Protein Sequence
APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
Gene References into Functions
  1. Our main findings demonstrate that 2-h swim exercise rapidly (i.e., immediately postexercise) increased Vegf-a mRNA levels in both subcutaneous (iWAT) and intra-abdominal (eWAT, rpWAT) adipose tissue of male Wistar rats after 2 weeks of high fat diet but not in rats kept on low fat diet. PMID: 29486133
  2. the epigenetic mechanisms involved in the physical exercise-mediated induction of VegfA expression, were examined. PMID: 27975171
  3. Our data suggest that activation of the GPR91-ERK1/2-C/EBP beta (c-Fos, HIF-1a) signaling pathway plays a tonic role in regulating VEGF transcription in rat retinal ganglion cells. PMID: 28374767
  4. present results suggested that pathologically high cyclic stretch induces the shuttling of SRSF1 which results in the secretive pattern splicing of VEGFA and finally contributes to the proliferation of vascular smooth muscle cells. PMID: 29974845
  5. Results indicate that vascular endothelial growth factor (VEGF) is a vital important factor that contributes to the small-airway remodelling in a rat model of Chronic obstructive pulmonary disease through promoting angiogenesis, which mainly depend on the specific binding between VEGF and VEGF receptor 1 and can be effectively attenuated by sunitinib. PMID: 28117425
  6. 150-kDa oxygen-regulated protein (ORP150) levels were significantly increased in rat retinas after induction of diabetes. Vascular endothelial growth factor (VEGF) and the pro-inflammatory cytokines interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha) induced upregulation of ORP150 in HRMEC. PMID: 29098793
  7. Expression of vascular endothelial growth factor in cardiac repair: Signaling mechanisms mediating vascular protective effects PMID: 29462681
  8. VEGF-A expression in soft tissues repaired by shockwave therapy PMID: 29921384
  9. While the mRNA expression of the proangiogenic factors VEGF, transforming growth factor-beta1 (TGF-beta1), and adrenomedullin dropped at 0 h post-hypoxia compared to normoxic control, no changes were detected at the protein level, showing an impaired response of these proangiogenic factors to hypoxia in the aged striatum PMID: 28501895
  10. Kisspeptin-10 prevents the increased vascular permeability of ovarian hyperstimulation syndrome by the activation of KISS1R and the inhibition of VEGF. PMID: 28676533
  11. The results indicate that VEGF promotes endothelial progenitor cell differentiation and vascular repair through Cx43. PMID: 29065929
  12. The results obtained in the study revealed that down-regulation of VEGF by RNAi could be a novel target approach for the treatment of failure (UFF) in rats with peritoneal dialysis. PMID: 28733472
  13. VEGF165 induces differentiation of hair follicle stem cells into endothelial cells and plays a role in in vivo angiogenesis. PMID: 28244687
  14. Enhanced neuroprotective efficacy of bone marrow mesenchymal stem cells co-overexpressing BDNF and VEGF in a rat model of cardiac arrest-induced global cerebral ischemia PMID: 28492549
  15. this is the first report describing the use of novel polymeric gene carriers for the delivery of VEGF gene to DA neurons with improved transfection efficiency. Finally, the study will lead to a significant advancement in the field of non-viral Parkinson's Disease gene therapy treatment. PMID: 28025049
  16. the results indicate that, Osx-overexpression promotes ADSCs' osteogenesis both in vitro and in vivo, which could be enhanced by release of VEGF. PMID: 28107808
  17. Following IL-1beta (50mug/kg ip.) administration, a higher serum IL-1beta level was detected in females than in males. In male rats, IL-1beta decreased BDNF mRNA in all the brain structures, except for the pituitary, and VEGF mRNA in the amygdala. PMID: 27744091
  18. VEGF knockdown can enhance chondrogenesis and prevent osteoarthritis progression. PMID: 27164955
  19. Here we report for the first time the expression of a rare and unusually potent splice variant, VEGF 111 , in vivo in mammals. Our discovery of VEGF 111 in the uterus of both a eutherian (rat) and a marsupial (fat-tailed dunnart) suggests that the splice variant may be common to all mammals PMID: 27722773
  20. Data indicate vascular endothelial growth factor A (VEGFA) as a target gene of miR-200b. PMID: 28122882
  21. Our results suggest that hUCMSCs can promote ovarian expression of HGF, VEGF, and IGF-1 through secreting those cytokines, resulting in improving ovarian reserve function and withstanding ovarian senescence. PMID: 28279229
  22. We demonstrate that a fine balance of VEGF and angiopoietin signaling is required for the formation of a functional vascular network. PMID: 27868196
  23. results indicate that the paracrine factor, VEGF, derived from transplanted BM-MSCs, regulated the expression of miRNAs such as miRNA-23a and miRNA-92a and exerted anti-apoptotic effects in cardiomyocytes after MI PMID: 28662151
  24. VEGF expression increased markedly in the cerebellum and mildly in the occipital lobe following up to 4 weeks of exposure to 20-ppm methylmercury. VEGF expression was detected mainly in astrocytes of the blood brain barrier. Intravenous administration of anti-VEGF neutralizing antibody mildly reduced the rate of hind-limb crossing signs observed in MeHg-exposed rats. PMID: 28118383
  25. Overexpressed long non-coding RNA (lncRNA) ANRIL upregulates vascular endothelial growth factor (VEGF) and promotes angiogenesis by activating NF-kappa B (NF-kappaB) signaling pathway in diabetes mellitus (DM) combined with cerebral infarction (DM + CI) rats. PMID: 28060742
  26. Vitexicarpine increased rats' survival time and decreased serum alpha-fetoprotein as well as it ameliorated fibrosis and massive hepatic tissue breakdown. It attenuated hepatocellular carcinoma-induced protein and gene expression of vascular endothelial growth factor PMID: 28651490
  27. Knockdown of hepatic VEGF decreases hepatic sdf1 expression and plasma sdf1 levels. PMID: 26939868
  28. XBP1 regulates VEGF-mediated cardiac angiogenesis. PMID: 27133203
  29. a novel rodent model to reproduce much of the known phenotype of CTEPH, including the pivotal pathophysiological role of impaired vascular endothelial growth factor-dependent vascular remodeling, is reported. PMID: 28183533
  30. VEGF treatment increases expression of HGF in vitro and in vivo and that, based on a series of integrative studies, we suggest that the effects of VEGF are mediated through downstream HGF signaling. PMID: 27036872
  31. MiR-21 exerts protective effects on endothelial injury through the PTEN/VEGF pathway after acute myocardial infarction. PMID: 27708252
  32. Chemerin and VEGF play important roles in diabetic nephropathy. PMID: 27612613
  33. Vegf expression is increased in brain from ischemic rats following treadmill exercise. PMID: 27747480
  34. these results suggested that miRNA-29a suppresses cardiac fibrosis and fibroblasts proliferation via targeting VEGF-A/MAPK signal pathway implicating that miRNA-29a might play a role in the treatment of cardiac fibrosis. PMID: 27060017
  35. Data suggest that a vascular endothelial growth factor (VEGF) signaling defect possibly plays an important role in defective embryonic airway branching. PMID: 27372649
  36. the inhibitory effect of miR1405p on angiogenesis was attenuated by the overexpression of VEGFA. PMID: 27035554
  37. we aimed to investigate the effect on angiogenesis of endoglin and VEGF expression in 1, 2-dimethylhydrazine dihydrochloride (DMH)-induced rat colon carcinogenesis and evaluated the implementation of COX2 inhibitors for molecular targets on tumor considering the above-mentioned mechanisms. PMID: 27466499
  38. This study demonstrated that vegf increases in male rat with aneurysmal subarachnoid hemorrhage. PMID: 26923576
  39. This study demonstrates that hyperthyroidism may have an effect on the development of rat adrenal glands mediated by VEGF expression, angiogenesis, and apoptosis. PMID: 26708182
  40. This PHD-2-mediated transcriptional activation may be important for regulating VEGF expression through HIF-1a signaling in LCs during corpus luteum development in mammals. PMID: 26681021
  41. Results indicate that chronic stress enhances vulnerability of brain-derived neurotrophic factor and vascular endothelial growth factor response to neuroinflammation. PMID: 26396035
  42. Identify a mechanism of VEGF overexpression in liver and mesentery that promotes pathologic, but not physiologic, angiogenesis, via sequential and nonredundant functions of CPEB1 and CPEB4. PMID: 26627607
  43. The increased level of VEGF expression in the nicotine-treated group may have affected endothelial cell apoptosis PMID: 27363062
  44. TP53, BCL-2, and VEGFA genes may participate in the proliferation of esophagus cancer cells in a synergistic manner PMID: 26439224
  45. results indicate OVX may induce 3-D capillary regression in soleus muscle through an imbalance between VEGF-A and TSP-1 expression, possibly associated with decreased exercise tolerance in ovariectomized rats. PMID: 26092525
  46. PHD2-mediated transcriptional activation may be one of the mechanisms regulating VEGF expression in luteal cells during mammalian corpus luteum development. PMID: 25975603
  47. Cardiomyocyte VEGF activates EC Notch signaling, facilitating GPIHBP1-mediated translocation of LPL across EC and regulating LPL-derived fatty acid delivery to the cardiomyocytes. PMID: 26586663
  48. Expression in control and blank groups was similar at 3 and 6 months. Atorvastatin can inhibit VEGI and vascular endothelial growth factor expression to protect rats from diabetic retinopathy PMID: 26125742
  49. VEGF is implicated in the pathogenesis of inflammation after electrical burns. PMID: 25466960
  50. No significant differences were noted in the expression of VEGF in rat tympanic membrane perforation. PMID: 25920966

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Expressed in the pituitary, in brain, in particularly in supraoptic and paraventricular nuclei and the choroid plexus. Also found abundantly in the corpus luteum of the ovary and in kidney glomeruli. Expressed in the ductal epithelial cells of post-pubert
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*