Recombinant Sheep Fibroblast growth factor 2 (FGF2) (Active)

In Stock
Code CSB-YP008625SH
Abbreviation Recombinant Sheep FGF2 protein (Active)
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 3.791-5.569 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 3.791-5.569 ng/mL.
Target Names
Uniprot No.
Alternative Names
Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF); Heparin-binding growth factor 2 (HBGF-2); FGF2
Species
Ovis aries (Sheep)
Source
Yeast
Expression Region
10-155aa
Target Protein Sequence
PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Mol. Weight
17.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

FGF2 is a critical mitogen in mesenchymal and neuroectodermal lineage biology, and this recombinant sheep ortholog spans the complete mature protein (aa 10–155), preserving the heparin-binding domain essential for receptor engagement and signaling. Functional validation demonstrates dose-dependent proliferation of NIH-3T3 fibroblasts with an ED50 of 3.791–5.569 ng/mL, confirming receptor-binding potency that supports use in cell proliferation assays, stem cell maintenance protocols, and osteogenic or neuronal differentiation studies where FGF2 serves as a defined medium supplement. Yeast expression yields a non-glycosylated protein that recapitulates the native mature form, providing a suitable basis for receptor-ligand binding experiments, including ELISA and surface plasmon resonance competition assays. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in angiogenesis models, wound healing assays, and antibody characterization workflows requiring low-background, bioactive growth factor preparations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
Gene References into Functions
  1. FGF2 mRNA expression was higher in immature and mature oocytes and gradually decreases from 2-cell stage of embryo to the blastocyst stage; a significant differences in FGF2 mRNA expression were observed between immature oocytes and all pre-implantation stages of embryo. PMID: 29638025
  2. this study demonstrated the presence of fibroblast growth factor 2 in ovine ovaries and that it inhibits apoptosis and promotes ovine follicle growth PMID: 24750547
  3. These results suggest that bFGF, VEGF-C and PDGF-C have roles in the pathogenesis of ovine pulmonary adenomatosis. PMID: 22721818
  4. proximal fibroblast growth factor (FGF2/FGFR1) signaling is compartmentalized in the placental endothelial caveolae via the FGFR substrate 2alpha that mediates formation of a FRS2alpha-GRB2-GAB1 complex PMID: 22674390
  5. Exogenous human FGF-2 increased endogenous FGF-2 promoter activity and protein levels in ovine pulmonary arterial smooth muscle cells. PMID: 17942638
  6. Reduced fetal and placental weights in twins and/or triplet pregnancies are associated with an overall decrease in total placental vascularity, VEGF and FGF2 and/or FGFR protein expression. PMID: 18392787

Show More

Hide All

Subcellular Location
Secreted. Nucleus.
Protein Families
Heparin-binding growth factors family
Database Links

KEGG: oas:443306

UniGene: Oar.394

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*