Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 3.791-5.569 ng/mL.

Target Names

FGF2

Uniprot No.

P20003

Alternative Names

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF); Heparin-binding growth factor 2 (HBGF-2); FGF2

Species

Ovis aries (Sheep)

Source

Yeast

Expression Region

10-155aa

Target Protein Sequence

PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Mol. Weight

17.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

FGF2 is a critical mitogen in mesenchymal and neuroectodermal lineage biology, and this recombinant sheep ortholog spans the complete mature protein (aa 10–155), preserving the heparin-binding domain essential for receptor engagement and signaling. Functional validation demonstrates dose-dependent proliferation of NIH-3T3 fibroblasts with an ED50 of 3.791–5.569 ng/mL, confirming receptor-binding potency that supports use in cell proliferation assays, stem cell maintenance protocols, and osteogenic or neuronal differentiation studies where FGF2 serves as a defined medium supplement. Yeast expression yields a non-glycosylated protein that recapitulates the native mature form, providing a suitable basis for receptor-ligand binding experiments, including ELISA and surface plasmon resonance competition assays. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in angiogenesis models, wound healing assays, and antibody characterization workflows requiring low-background, bioactive growth factor preparations.

Target Background

Function

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.

Gene References into Functions

FGF2 mRNA expression was higher in immature and mature oocytes and gradually decreases from 2-cell stage of embryo to the blastocyst stage; a significant differences in FGF2 mRNA expression were observed between immature oocytes and all pre-implantation stages of embryo. PMID: 29638025
this study demonstrated the presence of fibroblast growth factor 2 in ovine ovaries and that it inhibits apoptosis and promotes ovine follicle growth PMID: 24750547
These results suggest that bFGF, VEGF-C and PDGF-C have roles in the pathogenesis of ovine pulmonary adenomatosis. PMID: 22721818
proximal fibroblast growth factor (FGF2/FGFR1) signaling is compartmentalized in the placental endothelial caveolae via the FGFR substrate 2alpha that mediates formation of a FRS2alpha-GRB2-GAB1 complex PMID: 22674390
Exogenous human FGF-2 increased endogenous FGF-2 promoter activity and protein levels in ovine pulmonary arterial smooth muscle cells. PMID: 17942638
Reduced fetal and placental weights in twins and/or triplet pregnancies are associated with an overall decrease in total placental vascularity, VEGF and FGF2 and/or FGFR protein expression. PMID: 18392787

Hide All

Subcellular Location

Secreted. Nucleus.

Protein Families

Heparin-binding growth factors family

Database Links

KEGG: oas:443306

UniGene: Oar.394

Code	CSB-YP008625SH
Abbreviation	Recombinant Sheep FGF2 protein (Active)
MSDS	MSDS Datasheet
Size	$276
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity The ED₅₀ as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 3.791-5.569 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Sheep Fibroblast growth factor 2 (FGF2) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage