Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial

In Stock
Code CSB-EP005386TOTa2
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386TOTa2 could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005386TOTa2 could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CHRNA1
Uniprot No. P02710
Research Area Others
Alternative Names CHRNA1Acetylcholine receptor subunit alpha
Species Tetronarce californica (Pacific electric ray) (Torpedo californica)
Source E.coli
Expression Region 25-234aa
Target Protein Sequence SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 40.8kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

We ordered CSB-EP005386TOTa2, 0.5mg (LOT# 03270) and since our last order went exceptionally well and the protein we received shows promising results, we would like to order more.”
We are interested in 10mg and 25mg for CSB-EP005386TOTa2, please let me know if you can provide a good price for this returned customer. Please also provide me estimated lead time.
Thanks !

A:
Thanks so much for sharing the your feedback with us.
Now we still have 2mg of CSB-EP005386TOTa2 (LOT# 03270) in stock,the lead time for order quantity within 2mg is 3-7 working days
The lead time for 10mg is 20-30 working days and for 25mg is 30-40 working days. And we will also offer you the most reasonable price for bulk order.
Q:

We previously ordered lot# 03270 and lot# 03881 of CSB-EP005386TOTa2, 10mg. Do you have special price for us?
We would like to re-order and need the protein to be provided in lyophilization again, can you guarantee it?

A:
Thanks for your inquiry.
Please remark it's re-order from the lot# 03270 and lot# 03881 when you place the order, we now have 10.9mg of Lot#03881 in stock, but the package size is 1mg*6 vials+0.5mg*9 vials+0.05mg*8 vials.If you can accept this package size, lead time is 3-7 working days if the QC detection result is qualified.
Yes, we can guarantee to provide it in lyophilized form and surely we can offer a special price for you.

Target Data

Function After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1