Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial

In Stock
Code CSB-EP005386TOTa2
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P02710
Lead Time 3-7 business days
Relevance After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Tetronarce californica (Pacific electric ray) (Torpedo californica)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Research Area Others
Source E.coli
Gene Names CHRNA1
Expression Region 25-234aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 40.8kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Location Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-1/CHRNA1 sub-subfamily

Q&A and Customer Reviews

Q&A
Q:

We ordered CSB-EP005386TOTa2, 0.5mg (LOT# 03270) and since our last order went exceptionally well and the protein we received shows promising results, we would like to order more.”
We are interested in 10mg and 25mg for CSB-EP005386TOTa2, please let me know if you can provide a good price for this returned customer. Please also provide me estimated lead time.
Thanks !

A:
Thanks so much for sharing the your feedback with us.
Now we still have 2mg of CSB-EP005386TOTa2 (LOT# 03270) in stock,the lead time for order quantity within 2mg is 3-7 working days
The lead time for 10mg is 20-30 working days and for 25mg is 30-40 working days. And we will also offer you the most reasonable price for bulk order.
Q:

We previously ordered lot# 03270 and lot# 03881 of CSB-EP005386TOTa2, 10mg. Do you have special price for us?
We would like to re-order and need the protein to be provided in lyophilization again, can you guarantee it?

A:
Thanks for your inquiry.
Please remark it's re-order from the lot# 03270 and lot# 03881 when you place the order, we now have 10.9mg of Lot#03881 in stock, but the package size is 1mg*6 vials+0.5mg*9 vials+0.05mg*8 vials.If you can accept this package size, lead time is 3-7 working days if the QC detection result is qualified.
Yes, we can guarantee to provide it in lyophilized form and surely we can offer a special price for you.
Customer Reviews

Related Products

CHRNA1 Antibodies

CHRNA1 Antibodies for Tetronarce californica (Pacific electric ray) (Torpedo californica)

CHRNA1 Antibodies for Torpedo californica

CHRNA1 Proteins

CHRNA1 Proteins for Tetronarce californica (Pacific electric ray) (Torpedo californica)

CHRNA1 Proteins for Torpedo californica (Pacific electric ray)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.