Recombinant Vaccinia virus Entry-fusion complex associated protein OPG095 (OPG099), partial

In Stock
Code CSB-YP324949VAA1
Abbreviation Recombinant Vaccinia virus OPG099 protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of L1R was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Target Names
OPG099
Uniprot No.
Research Area
Others
Alternative Names
L1R; Protein L1; Virion membrane protein M25
Species
Vaccinia virus (strain Copenhagen) (VACV)
Source
Yeast
Expression Region
2-183aa
Target Protein Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.9kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Protein L1 (L1R) is produced in a yeast expression system and includes a partial sequence from amino acids 2 to 183. The protein carries an N-terminal 10xHis tag for easier purification and detection. SDS-PAGE analysis confirms the product achieves greater than 90% purity, which should meet the standards needed for reliable experimental work.

The L1 protein appears to play a crucial role in the Vaccinia virus life cycle, particularly during viral membrane assembly and maturation. Being part of the poxvirus family, L1 represents an important target for researchers studying viral entry and how viruses interact with their hosts. Its structural and functional features make it a valuable tool for investigating viral pathogenesis and vaccine development, though the complexity of viral systems means other factors likely contribute as well.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant L1R protein fragment are unknown and cannot be assumed. While the high purity (>95% by SEC-HPLC) indicates a monodisperse preparation suggestive of a homogeneous sample, the protein is expressed as a partial fragment (2-183aa) in a yeast system. Vaccinia virus L1R is a membrane protein that requires correct disulfide bond formation for its function in viral entry. Although yeast can perform eukaryotic post-translational modifications, the N-terminal His-tag and the truncation may affect the native structure. The protein's ability to bind its physiological targets (e.g., cell surface receptors or other viral proteins) remains unverified. Therefore, applications relying on specific biological interactions are speculative without validation.

1. Antibody Development and Immunoassay Research

This recombinant L1R fragment is suitable for use as an immunogen to generate antibodies. The high purity and His-tag facilitate purification and immobilization for screening. However, the antibodies generated will be against this specific fragment. Their ability to recognize the full-length, natively folded L1 protein in the context of the mature virion (MV) or intracellular mature virion (IMV) is not guaranteed and must be empirically validated. The recombinant L1R protein is reliable for developing ELISA assays to detect antibodies against this immunogen.

2. Protein-Protein Interaction Studies

The His-tagged protein can be used in pull-down assays. However, the utility for identifying physiologically relevant interactions is contingent on correct folding. L1R's role in viral entry involves specific interactions; if this fragment is misfolded, it may not bind authentic partners, leading to false negatives or non-specific bindings. This application is high-risk without prior confirmation of native folding and activity.

3. Biochemical Characterization and Binding Assays

This recombinant L1R protein is well-suited for biochemical characterization of its intrinsic properties, such as thermal stability and pH tolerance. However, "binding assays" to measure interactions with "potential ligands or other viral proteins" should not be attempted until the recombinant L1R protein's own bioactivity is confirmed. Without validation, binding data would be uninterpretable. The application should focus on stability and biophysical profiling first.

4. Vaccine Research and Immunogenicity Studies

This recombinant L1R protein can be evaluated as a subunit vaccine candidate. The key advantage is that antibody responses often target linear epitopes, so correct folding may be less critical for immunogenicity than for function. However, the protective efficacy of any immune response generated will depend on whether the antibodies can recognize the native protein on the virus. Preclinical studies can proceed, but the correlation between immunogenicity and protection must be established experimentally.

Final Recommendation & Action Plan

The immediate priority is to validate the recombinant L1R protein's bioactivity using a functional assay, such as its ability to bind known targets (e.g., specific antibodies or receptors) or to elicit neutralizing antibodies in a viral entry inhibition assay. Given the high SEC-HPLC purity, the protein is an excellent candidate for such validation. If functional activity is confirmed, it becomes highly valuable for interaction studies (Application 2) and binding assays (Application 3). If inactive, its use should be restricted to antibody generation (Application 1) and vaccine immunogenicity studies (Application 4), with the clear understanding that the immune response may not fully reflect immunity to the native viral protein. Biochemical characterization (Application 3) remains valid regardless of activity. All applications should include controls to account for potential tag-mediated interactions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.
Subcellular Location
Virion membrane; Single-pass membrane protein.
Protein Families
Chordopoxvirinae L1 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*