Recombinant Vaccinia virus Protein L1 (L1R), partial

In Stock
Code CSB-EP324949VAA1
Abbreviation Recombinant Vaccinia virus L1R protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
L1R; Protein L1; Virion membrane protein M25
Species
Vaccinia virus (strain Copenhagen) (VACV)
Source
E.coli
Expression Region
2-183aa
Target Protein Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant Vaccinia virus Protein L1 (L1R) is expressed in E. coli and corresponds to amino acids 2-183 of the L1R protein. The construct includes both an N-terminal 10xHis-tag and a C-terminal Myc-tag, which should make purification and detection more straightforward. SDS-PAGE analysis confirms the protein achieves greater than 85% purity - a level that appears suitable for most research purposes.

Protein L1 represents a crucial component of the Vaccinia virus envelope. Its role in the viral life cycle seems particularly important for virus assembly and egress, though the exact mechanisms may be more complex than initially understood. This makes L1 an intriguing target for researchers trying to piece together viral replication patterns and pathogenesis. Scientists often turn to L1 when investigating how viral infections progress and where therapeutic interventions might prove effective.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Vaccinia virus L1R is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic viral membrane proteins. L1R is a viral membrane protein that requires precise folding, proper disulfide bond formation, and likely specific post-translational modifications for its role in viral entry and membrane fusion. The protein is expressed as a partial fragment (2-183aa) with dual tags (N-terminal 10xHis and C-terminal Myc), which may significantly interfere with proper folding and membrane association. E. coli lacks the eukaryotic chaperones and modification machinery necessary for the correct folding of complex viral membrane proteins. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its structural integrity and membrane-binding capability.

1. Antibody Development and Immunoassay Studies

The recombinant L1R fragment can serve as an effective immunogen to generate antibodies that recognize linear epitopes within the 2-183aa region, even when the protein is misfolded. The dual tags facilitate purification and detection. However, antibodies may not recognize conformational or modification-dependent epitopes of native, membrane-associated L1R in viral particles. Validation against native L1R from vaccinia virus is recommended.

2. Protein-Protein Interaction Studies

This application is high-risk without folding validation. While the tags enable technical feasibility for pull-down assays, if L1R is misfolded (as expected in E. coli), it will not interact physiologically with true binding partners. Viral membrane proteins require specific conformations for proper interactions with host cell receptors and other viral components. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding.

3. ELISA-Based Binding Assays

This application should be approached with caution. If L1R is misfolded, binding assays will not reflect biological reality. The tags enable technical development of ELISA formats, but results may be misleading without proper folding validation. Membrane protein binding studies require native conformation for meaningful results.

4. Western Blot Standard and Positive Control

This application is appropriate and represents a safe use case. The recombinant L1R protein can serve as a positive control for Western blot detection of L1R, providing a known molecular weight reference. The dual tags offer multiple detection options. However, the migration pattern may not exactly match native L1R due to potential differences in folding and modification.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this viral membrane protein, we recommend first performing biophysical characterization to assess folding quality. This should include circular dichroism spectroscopy for secondary structure analysis and non-reducing SDS-PAGE for disulfide bond assessment. Antibody development and use as a Western blot standard can proceed as the safest applications. Avoid all functional studies (interactions, binding assays) until proper folding is validated. For reliable L1R functional studies, obtain full-length protein from eukaryotic expression systems capable of proper membrane protein folding and post-translational modifications. Always validate findings with native L1R from vaccinia virus particles when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell.
Subcellular Location
Virion membrane; Single-pass membrane protein.
Protein Families
Chordopoxvirinae L1 family
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*