Recombinant Xenopus laevis Transforming growth factor beta-1(TGFB1)

Code CSB-YP023446XBE
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names tgfb1
Uniprot No. P16176
Research Area Signal Transduction
Alternative Names tgfb1; Transforming growth factor beta-1 proprotein; TGF-beta-5) [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor beta-1; TGF-beta-1)]
Species Xenopus laevis (African clawed frog)
Source Yeast
Expression Region 271-382aa
Target Protein Sequence GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 14.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Important role in certain aspects of differentiation.
Gene References into Functions
  1. These data indicate that TGF-beta signaling is crucial for the function of the transition zone, which in turn may affect the regulation of cilia length. PMID: 25959824
  2. R-Smads are the key components of TGFbeta beta signals in germ layer induction. SCP3 serves as a vegetally enriched, intrinsic factor to ensure a prepared status of Smads for their activation. PMID: 26013826
  3. the present in vitro system, which permits not only the cell contraction-mediated cell sorting but also the TGF-b-directed mesodermal induction such as cartilage formation, may fairly reflect the embryogenesis in vivo. PMID: 23435857
  4. TGF-beta signaling has a role in nuclear localization of transcription factor Smad4 PMID: 22689943
  5. sortilin negatively regulates TGF-beta signaling by diverting trafficking of precursor proteins to the lysosome during transit through the biosynthetic pathway PMID: 21521695

Show More

Hide All

Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

KEGG: xla:397778

UniGene: Xl.861

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1