Recombinant Xenopus laevis Transforming growth factor beta-1(TGFB1)

Code CSB-YP023446XBE
Product Type Recombinant Protein
Size US$2959
Uniprot No. P16176
Relevance Important role in certain aspects of differentiation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias TGF-beta-5
Species Xenopus laevis (African clawed frog)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Research Area Signal Transduction
Source Yeast
Gene Names tgfb1
Protein Names Recommended name: Transforming growth factor beta-1 Short name= TGF-beta-1 Alternative name(s): TGF-beta-5
Expression Region 271-382aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Important role in certain aspects of differentiation.
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

KEGG: xla:397778

UniGene: Xl.861

Pathway Hippo signaling pathway
MAPK signaling pathway
TGF-beta signaling pathway
Cell cycle
Cellular senescence
Osteoclast differentiation
Th17 cell differentiation
AGE-RAGE signaling pathway in diabetic complications
FoxO signaling pathway

Related Products

tgfb1 Antibodies

tgfb1 Antibodies for Xenopus laevis (African clawed frog)

tgfb1 Proteins

tgfb1 Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.