Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-YP613691HU(F) |
Size | Pls inquire |
Source | Yeast |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP613691HU(F)-B |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-BP613691HU(F) |
Size | Pls inquire |
Source | Baculovirus |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-MP613691HU(F) |
Size | Pls inquire |
Source | Mammalian cell |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | >85% (SDS-PAGE) |
Target Names | CCL14 |
Uniprot No. | Q16627 |
Research Area | Immunology |
Alternative Names | CC-1; CC-3; CCL14; CCL14_HUMAN; chemokine (C-C motif) ligand 14; Chemokine CC-1/CC-3; chemokine CC1; chemokine CC3; chemokine HCC1; chemokine HCC3; CKb1; HCC 1; HCC 3; HCC-1(1-74); HCC-1(9-74); HCC-1/HCC-3; HCC-3; HCC1; HEMOFILTRATE CC CHEMOKINE 1; MCIF; NCC-2; NCC2; new CC chemokine 2; SCYA14; SCYL2; small inducible cytokine subfamily A (Cys-Cys); member 14; Small-inducible cytokine A14; SY14 |
Species | Homo sapiens (Human) |
Expression Region | 20-93aa |
Target Protein Sequence | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Mol. Weight | 24.7kD |
Protein Length | Full Length of Mature Protein |
Tag Info | The following tags are available. N-terminal His-tagged Tag-Free The tag type will be determined during production process. If
you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time
may differ from different purchasing way or location, please kindly consult your local distributors
for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Datasheet | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | Intercrine beta (chemokine CC) family |
Tissue Specificity | Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma. |
Database Links |
HGNC: 10612 OMIM: 601392 KEGG: hsa:6358 UniGene: Hs.272493 |