Recombinant human Tumor necrosis factor receptor superfamily member 10D

Code CSB-YP082094h
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP082094h
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP082094h-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP082094h
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP082094h
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names TNFRSF10D
Uniprot No. Q9UBN6
Research Area Apoptosis
Alternative Names CD 264; CD264; DcR 2; DcR2; Decoy receptor 2; Decoy with truncated death domain; OTTHUMP00000123528; TNF receptor related receptor for TRAIL ; TNF related apoptosis inducing ligand receptor 4; TNF-related apoptosis-inducing ligand receptor 4; TNFRSF 10D; TNFRSF10D; TR10D_HUMAN; TRAIL R4; TRAIL receptor 4; TRAIL receptor with a truncated death domain; TRAIL-R4; TRAILR4; TRUNDD; Tumor necrosis factor receptor superfamily member 10D; Tumor necrosis factor receptor superfamily; member 10d; decoy with truncated death domain
Species Homo sapiens (Human)
Expression Region 58-208aa
Target Protein Sequence IPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLAS
Mol. Weight 20.3kD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed
Gene References into Functions
  1. The high-dose hook effect was apparent during ELISA testing of uDcR2 in chronic kidney disease (CKD) patients, yet dilution of the urine samples neutralized this effect. However, the use of a four-fold dilution of urine for uDcR2/cre testing may eliminate the high-dose hook effect and make it possible to effectively monitor the severity of TII in CKD patients. PMID: 29879421
  2. results suggest that CD264 is a surface marker of cellular age for bone marrow-derived mesenchymal stem cells. PMID: 28962588
  3. Urinary DcR2 could potentially serve as a novel biomarker for tubulointerstitial injury and may reflect senescence of renal proximal tubular cells in diabetic nephropathy. PMID: 28356293
  4. Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases. PMID: 26542757
  5. membrane expression more common in endometrioid endometrial cancer than in normal endometrium PMID: 24649804
  6. This study identified TNFRSF10D DNA methylation status as an independent prognostic biomarker for relapse-free survival and overall mortality in non-metastatic melanoma patients. PMID: 25003639
  7. The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival. PMID: 23584885
  8. the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis. PMID: 24211571
  9. TRAIL receptor-4 expression profiles on T cells might be important in revelation of rheumatoid arthritis pathogenesis. PMID: 20799941
  10. ANT2 shRNA treatment sensitized MCF7, T47 D, and BT474 cells to TRAIL-induced apoptosis by up-regulating the expression of TRAIL death receptors 4 and 5 (DR4 and DR5) and down-regulating the TRAIL decoy receptor 2 (DcR2). PMID: 20875141
  11. these results demonstrated that hypoxia-inducible factor 1alpha played a crucial role in regulating the transcription of DcR2. PMID: 20018172
  12. Enhanced expression of DcR2 promotes peripheral blood eosinophil survival in the airways of allergic asthmatics following segmental antigen challenge. PMID: 12421985
  13. Cytotoxicity and apoptosis induced by TRAIL to beta-cell lines CM were inhibited competitively by soluble TRAIL receptors, R1, R2, R3 or R4. PMID: 12488957
  14. Respiratory syncytial virus infection strongly up-regulated the expression of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and its functional receptors death receptor 4 (DR4) and DR5. PMID: 12915532
  15. Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. PMID: 14999791
  16. The DcR2 was found to have a truncated and non-functional death domain. PMID: 15538968
  17. CD8+ lymphocytes and NKT lymphocytes, but not CD4+ lymphocytes, express TRAIL-R4 PMID: 15919363
  18. Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R4. PMID: 15921376
  19. Preligand assembly domain-mediated ligand-independent association between TRAIL receptor 4 (TR4) and TR2 regulates TRAIL-induced apoptosis. PMID: 16319225
  20. DCR2 was found positive in 81 and 33% normal, 46 and 10% nodular hyperplasia, 74 and 36% PIN tissues, 87 and 89% low-grade carcinomas, and 100 and 93% high-grade carcinomas PMID: 16799475
  21. TRAIL-R4-beta is a new splice variant of TRAIL-receptor 4 lacking the cysteine rich domain 1 PMID: 16934748
  22. The specificity of DcR1- and DcR2-mediated TRAIL inhibition reveals an additional level of complexity for the regulation of TRAIL signaling. PMID: 16980609
  23. CASP8, DCR2, and HIN-1 methylation leads to progression of neuroblastoma PMID: 17545522
  24. These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors. PMID: 18460741
  25. DCR2-methylated patients showed significantly poorer 5-year event-free survival in the whole neuroblastoma group (43% PMID: 18980997
  26. High TRAIL death receptor 4 and decoy receptor 2 expression correlates with significant cell death in pancreatic ductal adenocarcinoma patients. PMID: 18981952
  27. Results indicate that disc cells, after herniation, undergo apoptotic cell death via the DR5/TRAIL pathway. PMID: 19730199

Show More

Hide All

Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta and heart.
Database Links

HGNC: 11907

OMIM: 603614

KEGG: hsa:8793

STRING: 9606.ENSP00000310263

UniGene: Hs.213467

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1