Recombinant Human Amphiregulin(AREG)

Code CSB-CF001986HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P15514
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECK YIEHLEAVTCKCQQEYFGERCGEK
Source in vitro E.coli expression system
Gene Names AREG
Protein Names Recommended name: Amphiregulin Short name= AR Alternative name(s): Colorectum cell-derived growth factor Short name= CRDGF
Expression Region 101-184
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Amphiregulin family
Database Links

HGNC: 651

OMIM: 104640

KEGG: hsa:374

STRING: 9606.ENSP00000370227

UniGene: Hs.270833

Pathway ErbB signaling pathway
Hippo signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway

Related Products

AREG Antibodies

AREG Antibodies for Homo sapiens (Human)

AREG Antibodies for Human

AREG Proteins

AREG Proteins for Homo sapiens (Human)

AREG ELISA Kit

AREG ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.