Recombinant Human B-cell differentiation antigen CD72 (CD72)

Code CSB-CF004955HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD72; B-cell differentiation antigen CD72; Lyb-2; CD antigen CD72
Species
Homo sapiens (Human)
Expression Region
1-359
Target Protein Sequence
MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in B-cell proliferation and differentiation.
Gene References into Functions
  1. Interferon-alpha-induced CD100 expression on naive CD8(+) T cells enhances antiviral responses to hepatitis C infection through CD72 signal transduction. PMID: 28222623
  2. Increased soluble CD72 in systemic lupus erythematosus is in association with disease activity and lupus nephritis PMID: 26883681
  3. CD72 expression on activated B cells of SLE patients was significantly lower than that of normal controls. sema3A enhanced CD72 expression of B cells, but it was still lower in SLE patients than in normal individuals. PMID: 24461079
  4. data demonstrated aberrant expression of CD72 exists on B cells of myasthenia gravis and multiple sclerosis patients and expression level of CD72 molecule has a significantly negative correlation with anti-AchR antibody levels in myasthenia gravis PMID: 23184497
  5. regulates serum immunoglobulin leveln and disease resistance in systemic lupus erythematosus PMID: 23268649
  6. CD72 mRNA expression level correlates with Sema4D expression in peripheral blood mononuclear cells in immune thrombocytopenia. PMID: 22111667
  7. CD100, CD72 and CD45 were expressed in placenta and exhibited different mRNA and protein levels in normal pregnancy and miscarriage. Protein levels were highly dysregulated around 10 weeks of gestation in first and second miscarriage placentas. PMID: 22606231
  8. CD100-CD72 interaction can be the mechanism by which NK cell communicate with B cells. PMID: 17786190
  9. Data show that ligation of CD72 with the BU40, or with rCD100 negatively regulates KIT-mediated mast cell proliferation, chemotaxis, and chemokine production. PMID: 20100931
  10. results indicated that the presence of CD72-*2 allele decreases risk for human systemic lupus erythematosus conferred by FCGR2B-232Thr, possibly by increasing the AS isoform of CD72 PMID: 15459183
  11. CD72 is a key molecule in regulating mature B cell differentiation; CD72 signaling reduces the expression of X-box binding protein 1 in B cells PMID: 16047337
  12. increased nucleotide mutation of CD72 mRNA accounts for the decreased expression level of CD72 in B cells, and it might be related to hyperactivity of B cells in patients with SLE PMID: 17121583
  13. CD72 polymorphisms are associated with age of appearing clinical manifestations in idiopathic thrombocytopenic purpura in Chinese patients. PMID: 18071878

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Pre-B-cells and B-cells but not terminally differentiated plasma cells.
Database Links

HGNC: 1696

OMIM: 107272

KEGG: hsa:971

STRING: 9606.ENSP00000259633

UniGene: Hs.116481

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1