Recombinant Human B-cell receptor-associated protein 31 (BCAP31)

Code CSB-CF002592HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
6C6 AG; 6C6 AG tumor associated antigen; 6C6-AG tumor-associated antigen; 6C6AG; 6C6AG tumor associated antigen; Accessory protein BAP 31; Accessory protein BAP31; B cell receptor associated protein 31; B-cell receptor-associated protein 31; BA31; BAP 31; Bap31; BAP31_HUMAN; BCAP 31; BCAP31; BCR associated protein Bap 31; BCR associated protein Bap31; BCR-associated protein 31; CDM; CDM protein; DXS1357E; MS950; p28; p28 Bap31; Protein CDM; RP23-329M9.5
Species
Homo sapiens (Human)
Expression Region
2-246
Target Protein Sequence
SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVL LVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEEN RSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPM DKKEE
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by stimulating the translocation of NDUFS4 and NDUFB11 from the cytosol to the mitochondria via interaction with TOMM40. In response to ER stress, delocalizes from the ER-mitochondria contact sites and binds BCL2. May be involved in CASP8-mediated apoptosis.
Gene References into Functions
  1. that BAP31 is a potential prognostic marker for colorectal cancer patients after surgery PMID: 29653744
  2. BAP31 expression is an independent prognostic factor for overall survival of patients with postoperative hepatocellular carcinoma (HCC), and low expression levels of BAP31 in HCC may indicate poor outcomes of HCC patient after surgical resection. PMID: 25980696
  3. results suggest that enhanced expression of csBAP31 contributes to poor survival of NSCLC cells PMID: 29145450
  4. This patient's clinical features, muscle histopathology, brain MRI features, and family history were suggestive of mitochondrial encephalopathy. Whole exome sequencing research study confirmed the diagnosis of BCAP31-associated encephalopathy, DDCH syndrome. PMID: 28332767
  5. Data characterized the biochemical properties of plant orthologs of human B-cell receptor-associated protein BAP31 (HsBAP31) termed 'plant BAP-like proteins' (PBL proteins). PMID: 27770627
  6. Data show that tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced endoplasmic reticulum (ER) stress was triggered by caspase-8-mediated cleavage of B cell receptor-associated protein 31 (BAP31). PMID: 26212606
  7. The C-terminal domain of BAP31 is exposed on the cell surface of human embryonic stem cells. PMID: 26102500
  8. both BCAP31 and ABCD1 were associated with hepatic cholestasis and death before 1 year. Remarkably, a patient with an isolated deletion at the 3'-end of SLC6A8 had a similar severe phenotype as seen in BCAP31 deficiency PMID: 24597975
  9. Transfected human respiratory syncytial virus SH protein co-localizes with transfected BAP31 in cells, and pulls down endogenous BAP31. PMID: 25854864
  10. In the titel. PMID: 25044748
  11. These findings provide, for the first time, mechanistic insights into how BAP31 regulates human embryonic stem cell stemness and survival via control of EpCAM expression. PMID: 24898727
  12. Hypomethylation in BCAP31 is associated with breast cancer. PMID: 24395279
  13. the lack of BAP31 disturbs endoplasmic reticulum (ER) metabolism and impacts the Golgi apparatus, highlighting an important role for BAP31 in ER-to-Golgi crosstalk. PMID: 24011989
  14. BAP31 and BiP are essential for dislocation of SV40 from the endoplasmic reticulum to the cytosol. PMID: 21947079
  15. Membrane-Associated RING-CH proteins MARCH VIII and MARCH IV associate with Bap31 and target CD81 and CD44 to lysosomes PMID: 21151997
  16. Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. PMID: 21183955
  17. Contiguous deletion of the X-linked adrenoleukodystrophy gene (ABCD1) and DXS1357E: a novel neonatal phenotype similar to peroxisomal biogenesis disorders. PMID: 11992258
  18. CASP8 cleavage product of BAP31 induces mitochondrial fission through endoplasmic reticulum calcium signals, enhancing cytochrome c release to the cytosol. PMID: 12668660
  19. Data describe a novel human member of the protein tyrosine phosphatase-like B (PTPLB) family, an integral protein of the endoplasmic reticulum membrane, as a BAP31-interacting protein. PMID: 15024066
  20. Cleavage of BAP31 leads to the generation of ER- localized, proapoptotic BAP20, which may mediate mitochondrion-ER cross talk through a Ca(2+)-dependent mechanism PMID: 15254227
  21. BAP31 may play a role in regulating intracellular trafficking of CD11b/CD18 in neutrophils PMID: 15294914
  22. We have characterized a molecular mechanism by which calnexin regulates ER-stress-mediated apoptosis in a manner independent of its chaperone functions but dependent of its binding to Bap31. PMID: 16858427
  23. Bap31 performs quality control on class I molecules in two distinct phases: by exporting peptide-loaded class I molecules to the ER/Golgi, and by retrieving class I molecules that have lost peptides in the acidic post-ER environment. PMID: 17056546
  24. Bap31 is a component of the endoplasmic reticulum (ER) quality control compartment and that it moves between the peripheral ER and a juxtanuclear ER or ER-related compartment distinct from the conventional ER-Golgi intermediate compartment. PMID: 18287538
  25. BAP31 associates with the N terminus of one of its newly synthesized client proteins, the DeltaF508 mutant of CFTR, and promotes its retrotranslocation from the endoplasmic reticulum and degradation by the cytoplasmic 26S proteasome system. PMID: 18555783
  26. Results identify B-cell-associated protein 31 as a novel binding partner of the high-risk human papillomavirus 16 E5 proteins and provide insight into how the E5 proteins may modulate the life cycle in differentiating cells. PMID: 18684816

Show More

Hide All

Involvement in disease
Deafness, dystonia, and cerebral hypomyelination (DDCH)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.
Protein Families
BCAP29/BCAP31 family
Tissue Specificity
Ubiquitous. Highly expressed in neurons and discrete endocrine cells.
Database Links

HGNC: 16695

OMIM: 300398

KEGG: hsa:10134

STRING: 9606.ENSP00000392330

UniGene: Hs.522817

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1