Recombinant Human Calcium uniporter protein, mitochondrial (MCU)

Code CSB-CF847694HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
MCU; C10orf42; CCDC109A; Calcium uniporter protein, mitochondrial; HsMCU; Coiled-coil domain-containing protein 109A
Species
Homo sapiens (Human)
Expression Region
51-351
Target Protein Sequence
VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria. Constitutes the pore-forming and calcium-conducting subunit of the uniporter complex (uniplex). Activity is regulated by MICU1 and MICU2. At low Ca(2+) levels MCU activity is down-regulated by MICU1 and MICU2; at higher Ca(2+) levels MICU1 increases MCU activity. Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways. Involved in buffering the amplitude of systolic calcium rises in cardiomyocytes. While dispensable for baseline homeostatic cardiac function, acts as a key regulator of short-term mitochondrial calcium loading underlying a 'fight-or-flight' response during acute stress: acts by mediating a rapid increase of mitochondrial calcium in pacemaker cells. participates in mitochondrial permeability transition during ischemia-reperfusion injury. Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake. Mitochondrial calcium uptake in skeletal muscle cells is involved in muscle size in adults. Regulates synaptic vesicle endocytosis kinetics in central nerve terminal. Involved in antigen processing and presentation.
Gene References into Functions
  1. MICU1 imparts the mitochondrial uniporter with the ability to discriminate between Ca(2+) and Mn(2+). PMID: 30082385
  2. Mitochondrial Ca(2+) uptake is controlled by protein arginine methyl transferase 1 that asymmetrically methylates MICU1, resulting in decreased Ca(2+) sensitivity. UCP2/3 normalize Ca(2+) sensitivity of methylated MICU1 and, thus, re-establish mitochondrial Ca(2+) uptake activity. PMID: 27642082
  3. VDAC1 allows Ca(2+) access to the MCU, facilitating transport of Ca(2+) to the matrix, and also from the IMS to the cytosol. Intra-mitochondrial Ca(2+) controls energy production and metabolism by modulating critical enzymes in the tricarboxylic acid (TCA) cycle and fatty acid oxidation. PMID: 29594867
  4. MICU2 restricts spatial crosstalk between InsP3R and MCU channels by regulating threshold and gain of MICU1-mediated inhibition and activation of MCU. PMID: 29241542
  5. The results highlight the dynamic nature of uniporter subunit assembly, which must be tightly regulated to ensure proper mitochondrial responses to intracellular Ca(2+) signals. PMID: 28396416
  6. MCU expression returned to physiological levels in visceral adipose tissue of patients after weight loss by bariatric surgery. Altered mitochondrial calcium flux in fat cells may play a role in obesity and diabetes and may be associated with the differential metabolic profiles of visceral and subcutaneous adipose tissue. PMID: 28790027
  7. Mitochondrial calcium uniporter plays an important role in hyperglycaemia-induced endothelial cell dysfunction. PMID: 28777009
  8. The studies findings in aging human skeletal muscle confirm the data obtained in mice and propose mitochondrial calcium uniporter and mitochondria-related proteins as potential pharmacological targets to counteract age-related muscle loss. PMID: 28039397
  9. decreased MCU expression in hypertensive with mutation cells contributed to dysregulated Ca(2+) uptake into the mitochondria PMID: 27471128
  10. The molecular structure and regulation of the MCU complex in addition to its pathophysiological role are discussed with particular attention to striated muscle tissues. Review. PMID: 26968367
  11. High MCU expression is associated with metastasis in hepatocellular carcinoma. PMID: 28650465
  12. Here, the authors determine the transmembrane orientation of EMRE, and show that its known MCU-activating function is mediated by the interaction of transmembrane helices from both proteins. PMID: 27099988
  13. Regulation of mitochondrial Ca(2+) suggests that MCU may play a pivotal role in the development of fibrosis and could potentially be a therapeutic target for pulmonary fibrosis. PMID: 28351840
  14. MCU downregulation hampered cell motility and invasiveness and reduced tumor growth, lymph node infiltration, and lung metastasis in triple-negative breast cancer xenografts. In MCU-silenced cells, production of mitochondrial reactive oxygen species (mROS) is blunted and expression of the hypoxia-inducible factor-1alpha (HIF-1alpha) is reduced, suggesting a signaling role for mROS and HIF-1alpha, downstream of mitochon... PMID: 27138568
  15. Reveal a distinct functional role for Cys-97 in mitochondrial reactive oxygen species sensing and regulation of MCU activity. PMID: 28262504
  16. Study indicates that inhibition of mitochondrial calcium uniporter can inhibit excessive mitophagy and protect the neurocytes from ischemia/reperfusion injury. PMID: 27288019
  17. Our experiments provide novel details about how MCU/EMRE is regulated by MICU1 and an original approach to investigate MCU/EMRE activation in intact cells. PMID: 26489515
  18. results suggest that N terminal domain of MCU is essential for the modulation of MCU function, although it does not affect the uniplex formation PMID: 26341627
  19. MCU-VDAC1 complex regulates mitochondrial Ca(2+) uptake and oxidative stress-induced apoptosis PMID: 25753332
  20. Loss of heterozygosity of MCU gene on chromosome 10q is associated with pancreatic cancer. PMID: 25824785
  21. Studies indicate the existence of an inner mitochondrial protein termed the mitochondrial calcium uniporter for calcium transport. PMID: 25999421
  22. analyses establish that MCU encodes the pore-forming subunit of the uniporter channel PMID: 23755363
  23. MCU plays a critical role in breast cancer cell migration by regulating store-operated Ca(2) entry. PMID: 25640838
  24. We review not only the biochemical identities and structures of the proteins required for mitochondrial Ca2+ uptake but also their implications in different physiopathological contexts. [review] PMID: 24366263
  25. ERp57 can regulate the expression of the mitochondrial calcium uniporter (MCU) and modulate mitochondrial calcium uptake PMID: 24815697
  26. study demonstrates that MCU overexpression is a feature of some breast cancers and that MCU overexpression may offer a survival advantage against some cell death pathways PMID: 23602897
  27. The mitochondrial calcium uniporter (MCU): molecular identity and physiological roles. PMID: 23400777
  28. the crucial role of MICU1 and MCU in mitochondrial Ca(2+) uptake in pancreatic beta-cells and their involvement in the positive feedback required for sustained insulin secretion. PMID: 22904319
  29. Functional characterization of the MCU protein; shows that it is necessary for mitochondrial calcium uptake. PMID: 21685888
  30. MCU is an oligomeric protein residing in the mitochondrial inner membrane that interacts with MICU1 and is necessary for mitochondrial calcium uniport. PMID: 21685886
  31. CCDC109A was identified in this large-scale proteomics analysis as a mitochondrial protein broadly expressed in many mouse tissues. The human protein was also confirmed to localize to mitochondria. PMID: 18614015

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
MCU (TC 1.A.77) family
Database Links

HGNC: 23526

OMIM: 614197

KEGG: hsa:90550

STRING: 9606.ENSP00000362144

UniGene: Hs.591366

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1