Recombinant Human Claudin-18 (CLDN18)

Code CSB-CF005498HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CLDN18; UNQ778/PRO1572; Claudin-18
Species
Homo sapiens (Human)
Expression Region
1-261
Target Protein Sequence
MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI YDGGARTEDEVQSYPSKHDYV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you tell me witch CLDN18 the product CSB-CF005498HU is? Is it 18.2 or 18.1?
I need the specific binder 18.2

A:
Thanks for your interests in our products, the CLDN18 of CSB-CF005498HU is 18.1 vision, if you need the 18.2 vision, please order the CSB-CF005498HU(A5). The detail is listed as follow:Recombinant Human Claudin-18(CLDN18)
CSB-CF005498HU(A5)
Express Region:1-261aa; full length protein, we do the Isoform A2
Tag information: The tag type will be determined during the manufacturing process.
Target protein sequence: (The complete sequence including tag sequene and any linker sequence will be shown on the COA report)

MAVTACQGLGFVVSLIGIAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV


Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. In this study, we found downregulation of miR-767-3p and upregulation of CLDN18 in lung adenocarcinoma tissue and cell lines. PMID: 29169410
  2. CDH17 and CLDN18 are useful target molecules. Their coupling can aid in the comprehensive detection and localization of gastric cancer metastases in vivo to overcome challenges associated with intratumoral heterogeneity. PMID: 27580354
  3. Bile duct adenocarcinoma cells overexpress claudin-18 via the EGFR/RAS/ERK pathway, contributing to cell proliferation and invasion. PMID: 28624624
  4. The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 downregulates claudin-18. These data also suggest that the loss of claudin-18 is associated with increased sensitization to aeroantigens and airway responsiveness PMID: 27215490
  5. suggest that the reduction of CLDN5, 7, and 18 expression loses the suppressive ability of interaction between PDK1 and Akt and causes sustained phosphorylation of Akt, resulting in the disordered proliferation in lung squamous carcinoma cells PMID: 27884700
  6. Data suggest that claudin-18 suppresses the abnormal proliferation and motility of lung epithelial cells mediated by inhibition of phosphorylation of pyruvate dehydrogenase kinase isoform 1 (PDK1) and proto-oncogene protein c-akt (Akt). PMID: 26919807
  7. Human fetal lungs at 23-24 weeks gestational age, the highest-risk period for developing bronchopulmonary dysplasia, a disease of impaired alveolarization, had significantly lower CLDN18 expression relative to postnatal lungs. PMID: 24787463
  8. Evaluated expression of claudins in gastric cancer and determined their significance for patient outcome. Claudin-3 and claudin-7 were expressed in 25.4% and 29.9% of gastric cancer tissues; 51.5% of gastric cancer tissues had reduced claudin-18. PMID: 24333468
  9. High levels of CLDN18 are associated with non-small-cell lung cancer. PMID: 24710653
  10. Downregulation of miR-1303 can inhibit proliferation, migration and invasion of gastric cancer cells by targeting CLDN18. PMID: 24647998
  11. Claudin-18 positivity is a specific phenotype that is characteristic of intestinal-type Mucinous borderline tumours of the ovary PMID: 23905715
  12. Down-regulation of claudin-18 is associated with the proliferative and invasive potential of gastric cancer. PMID: 24073219
  13. rate of CLDN18.2 positivity is high in pancreatic neoplasms whereby the expression is not limited to the primaries but is also maintained upon metastasis PMID: 23900716
  14. Claudin 10/18 are most commonly expressed in lung adenocarcinomas. Female patients and non-smokers express these claudins more commonly suggesting that they may play a part in the carcinogenesis of tobacco unrelated carcinoma. PMID: 22076167
  15. Claudin 18 (a marker for early carcinogenesis) is commonly expressed in precursor lesions of pancreatic ductal adenocarcinomas. Activation of the protein kinase C pathway might be involved in claudin 18 expression associated with carcinogenesis. PMID: 21832145
  16. Cldn18 is primarily regulated at the transcriptional level via specific protein kinase C signaling pathways and modified by DNA methylation PMID: 21381080
  17. These results suggest that CLDN18 may play an important role in biliary carcinogenesis. PMID: 21607649
  18. High claudin 18 is associated with intraductal papillary mucinous neoplasms of the pancreas. PMID: 21206985
  19. We revealed that claudin-18 expression correlates with poor survival in patients with colorectal cancer and is associated with the gastric phenotype. PMID: 20846265
  20. Loss of claudin expression may enhance the grade of malignancy of gastric cancer in vivo. PMID: 17459057
  21. We conclude that Cldn-18 is the dominant claudin in the TJ of SCE and propose that the change from a Cldn-18-deficient TJ in SqE to a Cldn-18-rich TJ in SCE contributes to the greater acid resistance of BE. PMID: 17932229
  22. Indicate that the PKC/MAPK/AP-1 dependent pathway regulates claudin-18a2 expression in gastric cells. PMID: 18032479
  23. Claudin 18 and annexin A8 are frequently highly overexpressed in infiltrating ductal adenocarcinomas. PMID: 18223320
  24. Claudin 18 staining can aid in diagnosis of gastrointestinal signet ring cell carcinoma. PMID: 18580680
  25. Increased expression of claudin-18 is associated with colitis. PMID: 18831034
  26. CLDN18.2 as a novel, highly attractive pan-cancer target for the antibody therapy of epithelial tumors. PMID: 19047087

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Isoform A1: Expression is restricted to the lung. Isoform A2: Expression is restricted to the stomach mucosa where it is predominantly observed in the epithelial cells of the pit region and the base of the gastric glands including exocrine and endocrine c
Database Links

HGNC: 2039

OMIM: 609210

KEGG: hsa:51208

STRING: 9606.ENSP00000183605

UniGene: Hs.655324

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1