Recombinant Human Cystine/glutamate transporter (SLC7A11)(K472Q,K473Q,R475Q,R478Q,K483Q,R486Q)

Code CSB-CF892171HU(A4)(M)
Abbreviation Recombinant Human SLC7A11 protein (Mutant type)
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Amino acid transport system xc-;Calcium channel blocker resistance protein CCBR1;Solute carrier family 7 member 11;xCT
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-501aa(K472Q,K473Q,R475Q,R478Q,K483Q,R486Q)
Target Protein Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDQQPQWFQIMSEQITQTLQIILEVVPEEDKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
Gene References into Functions
  1. the over-expression of SLC7A11, or supplementation with sufficiently cystine, or treatment with N-acetylcysteine significantly decreased P-gp expression and activity. It was suggested that ROS and SLC7A11/cystine were the two relevant factors responsible for the expression and function of P-gp, and that SLC7A11 might be a potential target modulating ADR resistance. PMID: 28630426
  2. In some breast cancer cells, xCT antiporter expression is upregulated through the antioxidant transcription factor Nrf2 and contributes to their requirement for glucose as a carbon source. PMID: 28429737
  3. accumulated mutant-p53 protein suppresses the expression of SLC7A11, a component of the cystine/glutamate antiporter, system xC(-), through binding to the master antioxidant transcription factor NRF2. PMID: 28348409
  4. System xC(-)-mediated TrkA activation therefore presents a promising target for therapeutic intervention in cancer pain treatment. PMID: 29761734
  5. High expression of cystine-glutamate antiporter SLC7A11 is associated with advanced pathological stages of liver carcinoma. SLC7A11 overexpression is a novel biomarker and a potential unfavorable prognostic factor as well as a potential therapeutic target for liver carcinoma. PMID: 29528250
  6. the level of antisense SLC7A11 was markedly reduced in epithelial ovarian cancer tissues and cell lines compared with those of normal control; reduction of antisense SLC7A11 level prompted ovarian cancer cell migration mainly by suppressing the expression of SLC7A11 PMID: 29441937
  7. CD44v9 in tumor specimens has potential as a novel indicator for identifying a cisplatin-chemoresistant population among urothelial cancer patients. CD44v8-10 contributes to reactive oxygen species defenses, which are involved in chemoresistance, by promoting the function of xCT, which adjusts the synthesis of glutathione. PMID: 29385995
  8. Oncogenic PIK3CA alters methionine and cysteine utilization, partly by inhibiting xCT to contribute to the methionine dependency phenotype in human breast cancer cells. PMID: 29259101
  9. these observations suggest that SLC7A11 may be a vital biomarker for the diagnosis and prognosis in human laryngeal squamous cell carcinoma (LSCC) and targeting SLC7A11 appears to be a potentially significant method for LSCC treatment. PMID: 29048627
  10. Aberrant neuronal or neuroendocrine system may be involved in the suppressed reproductive performance in xCT deficient male mice. PMID: 28974116
  11. overexpression of SLC7A11 in the context of glioblastoma multiforme may contribute to tumor progression. PMID: 28610554
  12. miR-375 served as a tumor suppressor via regulating SLC7A11. PMID: 28627030
  13. As targets of oncogenes with intrinsic tyrosine kinase activity, STAT3 and STAT5 become constitutively active in hematologic neoplasms and solid tumors, promoting cell proliferation and survival and modulating redox homeostasis via regulation xCT expression. (Review) PMID: 28202313
  14. Authors found that the xCT expression was increased in peripheral blood monocyte of active tuberculosis. xCT expression in macrophage was induced by Mycobacterium tuberculosis (Mtb) through TLR2/Akt- and p38-dependent signaling pathway. PMID: 27129162
  15. Genetic and pharmacological inhibition of xCT potentiated the cytotoxic effects of aspirin plus sorafenib; this effect was diminished by xCT overexpression. Low-dose aspirin plus sorafenib enhanced the cytotoxicity of cisplatin in resistant HNC cells through xCT inhibition and oxidant and DNA damage. PMID: 28057599
  16. MUC1-C binds directly with CD44v and in turn promotes stability of xCT in the cell membrane PMID: 26930718
  17. simultaneous mutations at all four acetylation sites completely abolish its ability to regulate metabolic targets, such as TIGAR and SLC7A11. Moreover, p53(4KR) is still capable of inducing the p53-Mdm2 feedback loop, but p53-dependent ferroptotic responses are markedly abrogated PMID: 27705786
  18. ARF inhibits tumor growth by suppressing the ability of NRF2 to transcriptionally activate its target genes, including SLC7A11, a component of the cystine/glutamate antiporter that regulates reactive oxygen species (ROS)-induced ferroptosis. PMID: 28985506
  19. Mechanistically, CD44v interacts with and stabilizes xCT and thereby promotes the uptake of cysteine for glutathione synthesis and stimulates side-population cell enrichment. PMID: 27279909
  20. ATF4 expression fosters the malignancy of primary brain tumors and increases proliferation and tumor angiogenesis; experiments revealed that ATF4-dependent tumor promoting effects are mediated by transcriptional targeting the glutamate antiporter xCT PMID: 28553953
  21. Identify mTORC2 as a critical regulator of amino acid metabolism in cancer via phosphorylation of the cystine-glutamate antiporter xCT. mTORC2 phosphorylates serine 26 at the cytosolic N terminus of xCT, inhibiting its activity. PMID: 28648777
  22. Data suggest that glucose starvation of various neoplasm cell lines induces SLC7A11 expression; SLC7A11 overexpression decreases intracellular glutamate, an alternative source of metabolic energy; provision of alpha-ketoglutarate, a key downstream metabolite of glutamate, restores survival in SLC7A11-overexpressing neoplasm cell lines under glucose starvation. PMID: 28630042
  23. Results suggest that expression of SLC7A11 in the context of glioma contributes to tumorigenesis, tumor progression, and resistance to standard chemotherapy. PMID: 27658422
  24. High SLC7A11 expression is associated with glioma. PMID: 26980765
  25. The most frequent SLC7A7 mutation in Japanese LPI patients is p.R410*, which is a founder effect mutation in northern Japan. PMID: 26865117
  26. While the transsulfuration pathway plays a primary role in supplying Cys to the redox system in the liver, xCT is induced in cases of emergencies, by compensating for Cys supply systems. PMID: 28081640
  27. Although LCN2 increased intracellular iron concentrations, LCN2-induced GSH may catalyze and override oxidative stress via CD44 and xCT, and subsequently enhance the survival of clear cell carcinoma tumor cells in oxidative stress-rich environment. PMID: 26729415
  28. Study demonstrated that the mRNA expression levels of the two system xc- subunits, SLC7A11 and SLC3A2, in peripheral white blood cells are lowered in patients with schizophrenia than healthy individuals PMID: 26540405
  29. the rate of cystine uptake was significantly faster than the rate of glutamate release in human glioma cells. PMID: 26252954
  30. increased SLC7A11 expression predicted shorter malignant glioma patient survival. PMID: 26019222
  31. We discovered that many genes involved in oxidative stress/antioxidant defense system, apoptosis/anti-apoptosis/cell death, and cellular response to unfolded proteins/topologically incorrect proteins are potentially regulated by xCT. PMID: 25860939
  32. Data indicate that cystine-glutamate exchange transporter protein SLC7A11 mRNA is regulated by cellular stress and nonsense-mediated RNA decay (NMD). PMID: 25399695
  33. Sulfasalazine, a relatively non-toxic drug that targets cystine transporter, may, in combination with CDDP, be an effective therapy for colorectal cancer. PMID: 26254540
  34. These observations suggest that the expression of xCT in esophageal squamous cell carcinoma (ESCC) cells might affect the G1/S checkpoint and impact on the prognosis of ESCC patients PMID: 23771433
  35. Our findings indicate that miRNA-27a negatively regulates SLC7A11 in cisplatin-resistant bladder cancer, and shows promise as a marker for patients likely to benefit from cisplatin-based chemotherapy PMID: 24516043
  36. Results show that Nrf2 and ATF4 were upregulated by proteasome inhibition and cooperatively enhance human xCT gene expression upon proteasome inhibition. PMID: 25002527
  37. IGF-I regulates cystine uptake and cellular redox status by activating the expression and function of xCT in estrogen receptor-positive (ER(+)) breast cancer cells by a mechanism that relies on the IGF receptor substrate-1 (IRS-1). PMID: 24686172
  38. the xCT antiporter, which is expressed on one-third of triple-negative breast tumors in this study, may have a role in glutamine updake and dependence PMID: 24094812
  39. These findings suggest that xCT is an independent predictive factor in glioblastomas PMID: 23096413
  40. The pathways modify system activity beyond the level of xCT transcription, including regulation on the level of membrane trafficking and substrate availability, especially the regulation by glutamate transport through excitatory amino acid transporters. PMID: 21369940
  41. Both IGF-1 and TGF-beta stimulated system xc-mediated cystine uptake in dental pulp cells. PMID: 21689549
  42. Results reveal that increased expression of the cystine/glutamate antiporter system xCT in multiple sclerosis provides a link between inflammation and excitotoxicity in demyelinating diseases. PMID: 21639880
  43. SLC7A11 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells. PMID: 21555518
  44. Data show that SLC7A11 is the direct target of miR-26b and its expression is remarkably increased in both breast cancer cell lines and clinical samples. PMID: 21510944
  45. Review discusses system xc- function in vitro and in vivo, its role as an ambivalent drug target, and the relevance of oxytosis mediated by inhibition of xCT for identification of neuroprotective proteins and signaling pathways. PMID: 20053169
  46. The cystine/glutamate antiporter demonstrates its major role of cystine and glutamate transport while modulating intracellular glutathione content and efflux in dendritic cells during cell differentiation and cross-presentation in a transgenic system. PMID: 20733204
  47. x(c)(-) transporter provides a useful target for glioma therapy. PMID: 20007406
  48. Cys(327) is a functionally important residue accessible to the aqueous extracellular environment and is structurally linked to the permeation pathway and/or the substrate binding site PMID: 14722095
  49. topological model for xCT of 12 transmembrane domains with the N and C termini located inside the cell PMID: 15151999
  50. Expression of Tat led to decrease in glutathione and increase in gamma-glutamyl transpeptidase. The transport function of xc-was upregulated and was accompanied by increases in mRNAs for xCT and 4F2hc and in corresponding protein levels. PMID: 15326101

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family
Database Links

HGNC: 11059

OMIM: 607933

KEGG: hsa:23657

STRING: 9606.ENSP00000280612

UniGene: Hs.390594

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*