Recombinant Human Hydroxycarboxylic acid receptor 1(HCAR1)

Code CSB-CF861159HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9BXC0
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVA DFLLMICLPFRTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHP HHAVNTISTRVAAGIVCTLWALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIM FQLEFFMPLGIILFCSFKIVWSLRRRQQLARQARMKKATRFIMVVAIVFITCYLPSVSAR LYFLWTVPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPK QPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH
Source in vitro E.coli expression system
Gene Names HCAR1
Protein Names Recommended name: Hydroxycarboxylic acid receptor 1 Alternative name(s): G-protein coupled receptor 104 G-protein coupled receptor 81
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as a receptor for L-lactate and mediates its anti-lipolytic effect through a G(i)-protein-mediated pathway.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed abundantly in brown and white fat. It also detectable at lower levels in liver, kidney, skeletal muscle, brain and pituitary. Not detected in frontal, temporal and occipital lobes of the cortex, basal forebrain, caudate nucleus, nucleus accumben
Database Links

HGNC: 4532

OMIM: 606923

KEGG: hsa:27198

STRING: 9606.ENSP00000349478

UniGene: Hs.610873

Pathway cAMP signaling pathway

Related Products

HCAR1 Proteins

HCAR1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.