Recombinant Human Lysophosphatidic acid receptor 1 (LPAR1)

Code CSB-CF013047HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
LPAR1; EDG2; LPA1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2
Species
Homo sapiens (Human)
Expression Region
1-364
Target Protein Sequence
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND HSVV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are looking for some protein that can be used in u=immunization or for cell sort. would you please provide more information on what quantity QC data you will provide with production, such as purity, endotoxin level, Bioactivity, etc.

A:

We will perform QC test for purity(≥85%) and concentration via SDS-PAGE. We could offer Western Blot service for tag antibody free of charge, please this information when placing the order.

Q:

What format of this full length LPAR1 protein, is nanodisc or VLP?

A:

We can try to express this protein either detergent or Nanodisc

Q:

Would you please provide more information on what quantity QC data you will provide with production, such as purity, endotoxin level, Bioactivity, etc. WE are looking for some protein that can be used in u=immunization or for cell sort.

A:

For CSB-CF013047HU, we will perform QC test for purity(≥85%) and concentration via SDS-PAGE. We could offer Western Blot service for tag antibody free of charge, please this information when placing the order.
For CSB-MP013047HU VLP protein, we will perform QC test for concentration and WB test for tag antibody.
We could offer endotoxin removal service free of charge if you need. We use conjugated PMB affinity filler adsorption to remove endotoxin and guarantee endotoxin level within 0.1ng/ug(1EU/ug).
For activity, as we haven't expressed these proteins yet, their activity is NOT tested and NOT guaranteed.

Target Background

Function
Receptor for lysophosphatidic acid (LPA). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contributes to the responses to tissue damage and infectious agents. Activates downstream signaling cascades via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Signaling inhibits adenylyl cyclase activity and decreases cellular cAMP levels. Signaling triggers an increase of cytoplasmic Ca(2+) levels. Activates RALA; this leads to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate. Signaling mediates activation of down-stream MAP kinases. Contributes to the regulation of cell shape. Promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction. Promotes the activation of Rho and the formation of actin stress fibers. Promotes formation of lamellipodia at the leading edge of migrating cells via activation of RAC1. Through its function as lysophosphatidic acid receptor, plays a role in chemotaxis and cell migration, including responses to injury and wounding. Plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14. Promotes cell proliferation in response to lysophosphatidic acid. Required for normal skeleton development. May play a role in osteoblast differentiation. Required for normal brain development. Required for normal proliferation, survival and maturation of newly formed neurons in the adult dentate gyrus. Plays a role in pain perception and in the initiation of neuropathic pain.
Gene References into Functions
  1. ATX-LPA axis facilitates estrogen-induced endometrial cancer cell proliferation via MAPK/ERK signaling pathway. PMID: 29328374
  2. DLD-C-F cells formed large-sized colonies, but not DLD-F-C cells, correlating with LPAR1 and LPAR6 gene expression levels. These results suggest that LPA1 and LPA6 may regulate the colony formation activity in DLD1 cells treated with anticancer drugs. PMID: 29369010
  3. endogenous LPA1 receptor signaling and regulation PMID: 28943105
  4. The increased expression of LPA and LPAR1 is associated with the fibrosis and hypertrophy of the ligamentum flavum in patients with Lumbar Spinal Stenosis. PMID: 28323698
  5. myeloma cells stimulate mesenchymal stem cells (MSCs to produce autotaxin, an indispensable enzyme for the biosynthesis of lysophosphatidic acid, and LPA receptor 1 (LPA1) and 3 (LPA3) transduce opposite signals to MSCs to determine the fate of MSCs. PMID: 27641212
  6. LPA1 plays a critical role in EGF responses and that FFA4 agonists inhibit proliferation by suppressing positive cross-talk between LPA1 and the EGF receptor PMID: 27474750
  7. ADAMTS7 and LPA single nucleotide polymorphisms are related to a 24-h ambulatory systolic-diastolic pressure regression index. PMID: 28092973
  8. Polymorphism rs7023923 located near LPAR1 gene: the association of rs7023923 with monocytosis was confirmed among healthy blood donors (p = 0.0156) but not among patients admitted for elective coronarography (p = 0.61). PMID: 25563464
  9. These results suggest that autotaxin-LPA-LPA receptor 1-AKT1 signaling axis is critical for maintaining Cancer stem cells(CSC) characteristics through an autocrine loop and provide a novel therapeutic target for ovarian CSCs PMID: 26800320
  10. LPA-type agonist, via Carbonyl-oxygen/Lys39 interaction facilitates the formation of a hypothetical N-terminal cap tightly packed over the LPA1 heptahelical bundle. PMID: 26268898
  11. Data show high expression levels of LPAR2 and LPAR1 in endometrial cancer tissue with positive correlations with FIGO stage suggesting them as potential biomarkers for endometrial cancer progression. PMID: 26327335
  12. Data suggest LPA (lysophosphatidic acid; acting via LPAR1) and endothelin activate Cdc42, concurrent with biphasic decrease in Rac1 activity, differential effects on RhoA; LPA/endothelin stim. leads to remodeling of invadosomes in melanoma cells. PMID: 26740622
  13. we show that LPAR1 is a novel susceptibility gene for human essential hypertension and that stress, such as shortage of sleep, increases the susceptibility of patients with risk allele to essential hypertension. PMID: 26123684
  14. Study presents three crystal structures of LPA1 in complex with antagonist tool compounds selected and designed through structural and stability analyses. PMID: 26091040
  15. Results indicate that lysophosphatidic acid-lysophosphatidic acid receptor 1 (LPA-LPA1) signaling contributes to the activation of rheumatoid arthritis fibroblast-like synoviocytes (FLSs). PMID: 25273676
  16. Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line. PMID: 23838008
  17. LPA1 and LPA2 are major LPA receptor subtypes compared with low-expressed LPA3 in PANC-1 tumor cells. PMID: 24061591
  18. Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent. PMID: 23569130
  19. This review aims to characterize gintonin as an LPA receptor ligand and lists the advantages of LPA-ginseng protein complexes over free LPAs. PMID: 23017203
  20. study identified a novel role of TGFbeta in the control of LPA1 expression and LPA1-coupled biological functions, adding LPA1 to the list of TGFbeta-repressed target genes PMID: 22824789
  21. CD97 expression in human thyroid cancers correlated with LPA receptor and markers of aggressiveness including Ki67 and pAKT. PMID: 22797060
  22. a crosslink between Egr-1 and periostin in cancer cells PMID: 22659570
  23. The ability of LPA-LPA(1) signaling to promote epithelial cell apoptosis and fibroblast resistance to apoptosis may therefore contribute to the capacity of this signaling pathway to regulate the development of pulmonary fibrosis after lung injury. PMID: 22021336
  24. CD97 functioned to mediate invasion in prostate cancer cells, by associating with lysophosphatidic acid receptor 1 (LPAR1), leading to enhanced LPA-dependent RHO and extracellular signal-regulated kinase activation. PMID: 21978933
  25. the ATX-LPA-LPAR axis is a critical regulator of embryonic vascular development that is conserved in vertebrates PMID: 21971049
  26. This work shows for the first time that key components of the LPA pathway are modulated following traumatic brain injuries in humans. PMID: 21234797
  27. Mutation in LPA1 gene indicate that alteration in LPA receptor gene may play some role in the pathogenesis in human osteosarcoma cells. PMID: 21116120
  28. LPA1 receptor has a role in angiogenesis in tumor cells and xenografts PMID: 20708100
  29. Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients. PMID: 19860625
  30. show that human microglia express LPA receptor subtypes LPA(1), LPA(2), and LPA(3) on mRNA and protein level. LPA activation of C13NJ cells induced Rho and extracellular signal-regulated kinase activation and enhanced cellular ATP production. PMID: 19899077
  31. LP(A1) and myelin basic protein colocalized in brain, but oligodendrocyte soma showed stronger signals for LP(A1) than myelinated fibers, whereas the reverse was true for myelin basic protein so LP(A1) may be involved in myelin formation or maintenance. PMID: 11948806
  32. demonstrate that two biological fluids, blood plasma and seminal plasma, differentially activate LPA receptors PMID: 12123830
  33. Data suggest that LPA(1) receptors couple to a G(i)-phosphoinositide 3-kinase-Tiam1 pathway to activate Rac, with consequent suppression of RhoA activity, and thereby stimulate cell spreading and motility. PMID: 12393875
  34. lysophosphatidic acid-coupled LPA1/EDG-2 receptors are endocytosed via a dynamin2- and Rab5-dependent pathway PMID: 12668728
  35. LPA acts as a potent stimulator of colon cancer progression, although the binding to LPA1 and LPA2 induces slightly different responses. PMID: 12670925
  36. LPA stimulation promotes the interaction of the LPA(2) receptor with a focal adhesion molecule, TRIP6 PMID: 14688263
  37. EDG-2 expression was increased in low-grade adenoma compared with that in normal mucosa (P < 0.001). EDG-2 expression was significantly greater in adenomas with larger diameters (P < 0.001). PMID: 14696401
  38. Amyloid beta-protein stimulated in monocytes the gene expression for sphingosine-1-phosphate receptor 2, which is amyloid beta-protein-induced migration. PMID: 15208267
  39. data suggest that endothelial differentiation gene EDG-7 and EDG-2 lysophosphatidic acid receptors play a diverse role in mesangial cell proliferation PMID: 15292052
  40. formation of the LPA receptor/PDZ domain-containing RhoGEF complex plays a pivotal role in LPA-induced RhoA activation PMID: 15755723
  41. We show that in addition to promoting LPA(1) signaling, membrane cholesterol is essential for the association of LPA(1) with beta-arrestin, which leads to signal attenuation and clathrin-dependent endocytosis of LPA(1). PMID: 16263766
  42. These findings demonstrate that trafficking of LPA1 to the nucleus is influenced by cell-matrix interactions and that nuclear LPA1 may be involved in regulating intranuclear protein phosphorylation and signalling. PMID: 16716145
  43. LPA(1) transduces Galphai-dependent signals to promote nuclear localization of androgen receptor and cell proliferation PMID: 16809448
  44. EDG2 and EDG4 cooperate to promote LPA-stimulated chemotaxis in breast tumor cell lines. PMID: 17496233
  45. expression of LPA-induced inflammatory response genes is mediated by LPA1 and LPA3 PMID: 17923111
  46. Lysophosphatidic acid receptor 1 may contribute to the pathogenesis of rheumatoid arthritis through the modulation of fibroblast-like synoviocyte migration and cytokine production. PMID: 18006645
  47. distinct molecular mechanisms regulate agonist-dependent and PMA-dependent internalization of the LPA 1 receptor. PMID: 18089565
  48. Down-regulation of EDG2 is functionally important to suppression of tumor metastasis in breast neoplasms. PMID: 18089805
  49. Through the stepwise association study, an SNP located in the promoter region of EDG2 (-2,820G/A; rs10980705) showed significant association with knee osteoarthritis in two independent populations. PMID: 18325907
  50. LPA may play a role in angiogenesis of endometrium and placenta through induction of IL-8 in endometrial stromal cells during pregnancy. PMID: 18617617

Show More

Hide All

Subcellular Location
Cell surface. Cell membrane; Multi-pass membrane protein. Endosome.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in many adult organs, including brain, heart, colon, small intestine, placenta, prostate, ovary, pancreas, testes, spleen, skeletal muscle, and kidney. Little or no expression in liver, lung, thymus, or peripheral blood leukocytes. Detected in l
Database Links

HGNC: 3166

OMIM: 602282

KEGG: hsa:1902

STRING: 9606.ENSP00000351755

UniGene: Hs.126667

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1