Name: Recombinant Human Lysophosphatidic acid receptor 1 (LPAR1)
Brand: CUSABIO
SKU: CSB-CF013047HU

Product Details

Target Names

LPAR1

Uniprot No.

Q92633

Alternative Names

LPAR1; EDG2; LPA1; Lysophosphatidic acid receptor 1; LPA receptor 1; LPA-1; Lysophosphatidic acid receptor Edg-2

Species

Homo sapiens (Human)

Expression Region

1-364

Target Protein Sequence

MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND HSVV

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We are looking for some protein that can be used in u=immunization or for cell sort. would you please provide more information on what quantity QC data you will provide with production, such as purity, endotoxin level, Bioactivity, etc.

We will perform QC test for purity(≥85%) and concentration via SDS-PAGE. We could offer Western Blot service for tag antibody free of charge, please this information when placing the order.

What format of this full length LPAR1 protein, is nanodisc or VLP?

We can try to express this protein either detergent or Nanodisc

Would you please provide more information on what quantity QC data you will provide with production, such as purity, endotoxin level, Bioactivity, etc. WE are looking for some protein that can be used in u=immunization or for cell sort.

For CSB-CF013047HU, we will perform QC test for purity(≥85%) and concentration via SDS-PAGE. We could offer Western Blot service for tag antibody free of charge, please this information when placing the order.
For CSB-MP013047HU VLP protein, we will perform QC test for concentration and WB test for tag antibody.
We could offer endotoxin removal service free of charge if you need. We use conjugated PMB affinity filler adsorption to remove endotoxin and guarantee endotoxin level within 0.1ng/ug(1EU/ug).
For activity, as we haven't expressed these proteins yet, their activity is NOT tested and NOT guaranteed.

Target Background

Function

Receptor for lysophosphatidic acid (LPA). Plays a role in the reorganization of the actin cytoskeleton, cell migration, differentiation and proliferation, and thereby contributes to the responses to tissue damage and infectious agents. Activates downstream signaling cascades via the G(i)/G(o), G(12)/G(13), and G(q) families of heteromeric G proteins. Signaling inhibits adenylyl cyclase activity and decreases cellular cAMP levels. Signaling triggers an increase of cytoplasmic Ca(2+) levels. Activates RALA; this leads to the activation of phospholipase C (PLC) and the formation of inositol 1,4,5-trisphosphate. Signaling mediates activation of down-stream MAP kinases. Contributes to the regulation of cell shape. Promotes Rho-dependent reorganization of the actin cytoskeleton in neuronal cells and neurite retraction. Promotes the activation of Rho and the formation of actin stress fibers. Promotes formation of lamellipodia at the leading edge of migrating cells via activation of RAC1. Through its function as lysophosphatidic acid receptor, plays a role in chemotaxis and cell migration, including responses to injury and wounding. Plays a role in triggering inflammation in response to bacterial lipopolysaccharide (LPS) via its interaction with CD14. Promotes cell proliferation in response to lysophosphatidic acid. Required for normal skeleton development. May play a role in osteoblast differentiation. Required for normal brain development. Required for normal proliferation, survival and maturation of newly formed neurons in the adult dentate gyrus. Plays a role in pain perception and in the initiation of neuropathic pain.

Gene References into Functions

ATX-LPA axis facilitates estrogen-induced endometrial cancer cell proliferation via MAPK/ERK signaling pathway. PMID: 29328374
DLD-C-F cells formed large-sized colonies, but not DLD-F-C cells, correlating with LPAR1 and LPAR6 gene expression levels. These results suggest that LPA1 and LPA6 may regulate the colony formation activity in DLD1 cells treated with anticancer drugs. PMID: 29369010
endogenous LPA1 receptor signaling and regulation PMID: 28943105
The increased expression of LPA and LPAR1 is associated with the fibrosis and hypertrophy of the ligamentum flavum in patients with Lumbar Spinal Stenosis. PMID: 28323698
myeloma cells stimulate mesenchymal stem cells (MSCs to produce autotaxin, an indispensable enzyme for the biosynthesis of lysophosphatidic acid, and LPA receptor 1 (LPA1) and 3 (LPA3) transduce opposite signals to MSCs to determine the fate of MSCs. PMID: 27641212
LPA1 plays a critical role in EGF responses and that FFA4 agonists inhibit proliferation by suppressing positive cross-talk between LPA1 and the EGF receptor PMID: 27474750
ADAMTS7 and LPA single nucleotide polymorphisms are related to a 24-h ambulatory systolic-diastolic pressure regression index. PMID: 28092973
Polymorphism rs7023923 located near LPAR1 gene: the association of rs7023923 with monocytosis was confirmed among healthy blood donors (p = 0.0156) but not among patients admitted for elective coronarography (p = 0.61). PMID: 25563464
These results suggest that autotaxin-LPA-LPA receptor 1-AKT1 signaling axis is critical for maintaining Cancer stem cells(CSC) characteristics through an autocrine loop and provide a novel therapeutic target for ovarian CSCs PMID: 26800320
LPA-type agonist, via Carbonyl-oxygen/Lys39 interaction facilitates the formation of a hypothetical N-terminal cap tightly packed over the LPA1 heptahelical bundle. PMID: 26268898
Data show high expression levels of LPAR2 and LPAR1 in endometrial cancer tissue with positive correlations with FIGO stage suggesting them as potential biomarkers for endometrial cancer progression. PMID: 26327335
Data suggest LPA (lysophosphatidic acid; acting via LPAR1) and endothelin activate Cdc42, concurrent with biphasic decrease in Rac1 activity, differential effects on RhoA; LPA/endothelin stim. leads to remodeling of invadosomes in melanoma cells. PMID: 26740622
we show that LPAR1 is a novel susceptibility gene for human essential hypertension and that stress, such as shortage of sleep, increases the susceptibility of patients with risk allele to essential hypertension. PMID: 26123684
Study presents three crystal structures of LPA1 in complex with antagonist tool compounds selected and designed through structural and stability analyses. PMID: 26091040
Results indicate that lysophosphatidic acid-lysophosphatidic acid receptor 1 (LPA-LPA1) signaling contributes to the activation of rheumatoid arthritis fibroblast-like synoviocytes (FLSs). PMID: 25273676
Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line. PMID: 23838008
LPA1 and LPA2 are major LPA receptor subtypes compared with low-expressed LPA3 in PANC-1 tumor cells. PMID: 24061591
Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent. PMID: 23569130
This review aims to characterize gintonin as an LPA receptor ligand and lists the advantages of LPA-ginseng protein complexes over free LPAs. PMID: 23017203
study identified a novel role of TGFbeta in the control of LPA1 expression and LPA1-coupled biological functions, adding LPA1 to the list of TGFbeta-repressed target genes PMID: 22824789
CD97 expression in human thyroid cancers correlated with LPA receptor and markers of aggressiveness including Ki67 and pAKT. PMID: 22797060
a crosslink between Egr-1 and periostin in cancer cells PMID: 22659570
The ability of LPA-LPA(1) signaling to promote epithelial cell apoptosis and fibroblast resistance to apoptosis may therefore contribute to the capacity of this signaling pathway to regulate the development of pulmonary fibrosis after lung injury. PMID: 22021336
CD97 functioned to mediate invasion in prostate cancer cells, by associating with lysophosphatidic acid receptor 1 (LPAR1), leading to enhanced LPA-dependent RHO and extracellular signal-regulated kinase activation. PMID: 21978933
the ATX-LPA-LPAR axis is a critical regulator of embryonic vascular development that is conserved in vertebrates PMID: 21971049
This work shows for the first time that key components of the LPA pathway are modulated following traumatic brain injuries in humans. PMID: 21234797
Mutation in LPA1 gene indicate that alteration in LPA receptor gene may play some role in the pathogenesis in human osteosarcoma cells. PMID: 21116120
LPA1 receptor has a role in angiogenesis in tumor cells and xenografts PMID: 20708100
Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients. PMID: 19860625
show that human microglia express LPA receptor subtypes LPA(1), LPA(2), and LPA(3) on mRNA and protein level. LPA activation of C13NJ cells induced Rho and extracellular signal-regulated kinase activation and enhanced cellular ATP production. PMID: 19899077
LP(A1) and myelin basic protein colocalized in brain, but oligodendrocyte soma showed stronger signals for LP(A1) than myelinated fibers, whereas the reverse was true for myelin basic protein so LP(A1) may be involved in myelin formation or maintenance. PMID: 11948806
demonstrate that two biological fluids, blood plasma and seminal plasma, differentially activate LPA receptors PMID: 12123830
Data suggest that LPA(1) receptors couple to a G(i)-phosphoinositide 3-kinase-Tiam1 pathway to activate Rac, with consequent suppression of RhoA activity, and thereby stimulate cell spreading and motility. PMID: 12393875
lysophosphatidic acid-coupled LPA1/EDG-2 receptors are endocytosed via a dynamin2- and Rab5-dependent pathway PMID: 12668728
LPA acts as a potent stimulator of colon cancer progression, although the binding to LPA1 and LPA2 induces slightly different responses. PMID: 12670925
LPA stimulation promotes the interaction of the LPA(2) receptor with a focal adhesion molecule, TRIP6 PMID: 14688263
EDG-2 expression was increased in low-grade adenoma compared with that in normal mucosa (P < 0.001). EDG-2 expression was significantly greater in adenomas with larger diameters (P < 0.001). PMID: 14696401
Amyloid beta-protein stimulated in monocytes the gene expression for sphingosine-1-phosphate receptor 2, which is amyloid beta-protein-induced migration. PMID: 15208267
data suggest that endothelial differentiation gene EDG-7 and EDG-2 lysophosphatidic acid receptors play a diverse role in mesangial cell proliferation PMID: 15292052
formation of the LPA receptor/PDZ domain-containing RhoGEF complex plays a pivotal role in LPA-induced RhoA activation PMID: 15755723
We show that in addition to promoting LPA(1) signaling, membrane cholesterol is essential for the association of LPA(1) with beta-arrestin, which leads to signal attenuation and clathrin-dependent endocytosis of LPA(1). PMID: 16263766
These findings demonstrate that trafficking of LPA1 to the nucleus is influenced by cell-matrix interactions and that nuclear LPA1 may be involved in regulating intranuclear protein phosphorylation and signalling. PMID: 16716145
LPA(1) transduces Galphai-dependent signals to promote nuclear localization of androgen receptor and cell proliferation PMID: 16809448
EDG2 and EDG4 cooperate to promote LPA-stimulated chemotaxis in breast tumor cell lines. PMID: 17496233
expression of LPA-induced inflammatory response genes is mediated by LPA1 and LPA3 PMID: 17923111
Lysophosphatidic acid receptor 1 may contribute to the pathogenesis of rheumatoid arthritis through the modulation of fibroblast-like synoviocyte migration and cytokine production. PMID: 18006645
distinct molecular mechanisms regulate agonist-dependent and PMA-dependent internalization of the LPA 1 receptor. PMID: 18089565
Down-regulation of EDG2 is functionally important to suppression of tumor metastasis in breast neoplasms. PMID: 18089805
Through the stepwise association study, an SNP located in the promoter region of EDG2 (-2,820G/A; rs10980705) showed significant association with knee osteoarthritis in two independent populations. PMID: 18325907
LPA may play a role in angiogenesis of endometrium and placenta through induction of IL-8 in endometrial stromal cells during pregnancy. PMID: 18617617

Hide All

Subcellular Location

Cell surface. Cell membrane; Multi-pass membrane protein. Endosome.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in many adult organs, including brain, heart, colon, small intestine, placenta, prostate, ovary, pancreas, testes, spleen, skeletal muscle, and kidney. Little or no expression in liver, lung, thymus, or peripheral blood leukocytes. Detected in l

Database Links

HGNC: 3166

OMIM: 602282

KEGG: hsa:1902

STRING: 9606.ENSP00000351755

UniGene: Hs.126667

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-CF013047HU
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lysophosphatidic acid receptor 1 (LPAR1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage