Recombinant Human NADPH oxidase 1 (NOX1)-VLPs

In Stock
Code CSB-MP015959HU
Abbreviation Recombinant Human NOX1 protein-VLPs
MSDS
Size $744
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
The purity information is not available for VLPs proteins.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Mitogenic oxidase 1;NADH/NADPH mitogenic oxidase subunit P65-MOX;NOH-1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-564aa
Target Protein Sequence
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
66.2 kDa
Protein Length
Full Length
Tag Info
C-terminal Myc-tagged
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
NOH-1S is a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.
Gene References into Functions
  1. this study shows that NOX1 loss-of-function genetic variants in patients with inflammatory bowel disease PMID: 29091079
  2. depletion of NOX1 and NOX4 partially rescued the growth inhibition of PARP1-deficient tumor xenografts. Our findings suggest that in addition to compromising the repair of DNA damage, PARP inhibition or depletion may exert extra antitumor effect by elevating oxidative stress in ovarian cancer cells PMID: 29684820
  3. NOX activation might have a role in regulation of lymphocytic activity in patients with idiopathic nephrotic syndrome through the impairment of PDGF mitogenic function and might contribute toward pathogenesis of nephrotic syndrome. PMID: 28613279
  4. The SUMO1/UBC9 axis may regulate Nox1mediated diabetic retinopathy by inhibiting reactive oxygen species generation and apoptosis. PMID: 29138839
  5. Results show that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence and suggest potential targets for controlling the aging process at the molecular level. PMID: 29042481
  6. in CAD, both mitochondria and NADPH oxidase contribute to flow-induced vasodilation through a redox mechanism in visceral arterioles. PMID: 28480622
  7. NADPH oxidase-mediated redox signaling is important in the detrimental effect of C-reactive protein on pancreatic insulin secretion. PMID: 28778482
  8. S340E mutation enhances Nox1 activation (Kaito et al., 2014), the present study suggests that betaPix can also play an inhibitory role in O2(-) production, depending on the sites of phosphorylation. PMID: 29242061
  9. the anti-proliferative and pro-apoptotic effect of cambogin on breast adenocarcinoma is mediated via inducing NOX1-dependent ROS production and the dissociation of ASK1 and Trx1 PMID: 27418140
  10. Transcriptional regulation of NOX genes expression in human breast adenocarcinoma cells is modulated by adaptor protein CIN85. PMID: 29227594
  11. the transition-state substrate analogue inhibitor of Prdx6 phospholipase A2 activity (MJ-33) was shown to suppress Nox1 activity, suggesting Nox1 activity is regulated by the phospholipase activity of Prdx6. Finally, wild type Prdx6, but not lipase or peroxidase mutant forms, supports Nox1-mediated cell migration in the HCT-116 colon epithelial cell model of wound closure PMID: 27094494
  12. Cells redox environment mediated by NOX1 isozymes activation down-regulates BRCA1 expression and promotes DNA homologous recombination repair in cancer. PMID: 27771433
  13. LRRC8A channels support TNFalpha-induced superoxide production by Nox1 which is required for receptor endocytosis. PMID: 27838438
  14. These results are consistent with the hypothesis that antioxidants or NOX1/4 inhibition may be useful in blocking profibrotic effects of TGFbeta on dermal and gingival fibroblasts and warrant consideration for further development as potential antifibrotic agents PMID: 29049376
  15. We demonstrated that rapid deletion of p22phox is possible and that the activity of Nox1 and Nox4 but not Nox5 exclusively depends on p22phox. PMID: 27614387
  16. 5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension. PMID: 28473438
  17. NOX1 has a role in maintaining the proliferative phenotype of some colon cancers and has potential as a therapeutic target in this disease PMID: 28330872
  18. NOX1 mRNA was undetectable in the gastric mucosa. PMID: 27048452
  19. P38 MAPK, phosphorylated P38 MAPK, and RAC2 regulated in mutual feedback and negative feedback regulatory pathways, resulting in the radioresistance of G0 cells. PMID: 27936335
  20. NS5A contributes to reactive oxygen species production by activating expression of NADPH oxidases 1 and 4 as well as cytochrome P450 2E1. PMID: 27200149
  21. our results highlight that the Nox1/AKT signaling pathway plays an important role in cell survival in oral squamous cell carcinoma (OSCC) cells. PMID: 27600098
  22. p38 and NOX1 are essential for the protective effect of c-Myb and that NOX1 acts upstream of p38 activation. PMID: 27107996
  23. The results suggested that radiationinduced pulmonary fibrosis may be efficiently reduced by specific inhibition of NOX1, an effect mediated by reduction of fibrotic changes of ECs. PMID: 27053172
  24. Overexpression of NADPH oxidase 1 is associated with increased migration/metastasis rate in melanoma. PMID: 26760964
  25. The results of this study demonstrate that OA itself is not a cause to increase arNOX activities. PMID: 26339163
  26. These results indicate that physiological levels of ROS produced by the NOX complex modulate hippocampal neuronal polarity and axonal growth in vitro. PMID: 26101350
  27. High glucose generated an increase in NADPH oxidase activity and expression in human vascular smooth muscle cells. Sequence analysis of human Nox1, Nox4, and Nox5 gene promoters was performed. PMID: 25722086
  28. NOX1 and NOX4 signaling mediates the pathogenesis of liver fibrosis, including the direct activation of HSC. PMID: 26222337
  29. Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK. PMID: 26116564
  30. Increased NOX1 expression in gallbladder cancer cells promoted the chemoresistance of the cells through elevating intracellular reactive oxygen species level and HIF1a expression as well as increasing MDR1 expression. PMID: 26545779
  31. NLRP3 inflammasome activation and generation of pulmonary fibrosis is affected by NADPH oxidase by multi-walled carbon nanotubes PMID: 25581126
  32. NADPH oxidase 1 was responsible for superoxide generation and cell proliferation in low-density lipoprotein-stimulated aortic smooth muscle cells. PMID: 26065917
  33. High NADPH oxidase expression is associated with chronic myelogenous leukemia. PMID: 24833663
  34. Data show that lipopolysaccharide induced vascular endothelial cell migration is mediated by toll-like receptor TLR-4/NF-kappa B pathway and enzyme NAD(P)H oxidase in association with the transient receptor potential melastatin 7 (TRPM7) ion channel. PMID: 25130439
  35. Enforced NOX1 expression promoted TLR4 signaling-enhanced NSCLC metastasis. PMID: 25592377
  36. Studies indicate the role of 70 kDa heat-shock protein (HSP70) in the activation of NADPH oxidase isoforms and in islet alpha- and beta-cell physiological function in health and Type 2 diabetes mellitus. PMID: 25881670
  37. Data (including data from transgenic/knockout mice) suggest that inhibition of NOX1 and NOX2/CYBB (but not NOX4) in vascular endothelium conforms to current models for treatment of vascular diseases. [REVIEW] PMID: 25066192
  38. Nox1 post-translationally regulatedCK18 stability in a ROS-, phosphorylation- and PKCepsilon-dependent manner. It accelerates neoplastic progression by regulating structural intermediate filaments leading to epithelial mesenchymal transition. PMID: 24494188
  39. Elevated ROS derived from NOX1 activation and downregulation of SOD in NIH3T3RET-MEN2A and NIH3T3RET-MEN 2B cells may be involved in RET constitutive tyrosine auto-phosphorylation PMID: 24437351
  40. NOX1 is involved in acure respiratory distress syndrome pathophysiology and is responsible for the damage occurring in alveolar epithelial cells at least in part via STAT3 signalling pathways. PMID: 24551274
  41. NOX1 inhibition not only prevented iNOS induction but also abrogated changes consequent to iNOS induction such as mesangial fibrogenesis. PMID: 23801050
  42. BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation. PMID: 24792722
  43. Data from studies with Caco-2 cells (an in vitro model of inflammatory bowel disease) suggest a dietary component (antioxidant/pigment indicaxanthin in fruit of cactus pear) can prevent activation of NOX1/NFkB (nuclear factor kappa B) in enterocytes. PMID: 23931157
  44. p22(phox) directly contributes to Nox1 activation in a glycosylation-independent manner, besides its significant role in Nox1 glycan maturation. PMID: 24365146
  45. It is a superoxide producing enzyme.(review) PMID: 24334927
  46. Physical frailty in older people is associated with superoxide anion overproduction by NADPH oxidase and low-grade chronic inflammation. PMID: 22640231
  47. The activity of NADPH oxidase (NOX), a major superoxide-generating enzyme system, in peripheral blood lymphocytes (PBL) from galactosemia patients, was examined. PMID: 23828587
  48. Expression of NOX-1 in beta cells is regulated in a feed-forward loop mediated by reactive oxygen species and Src-kinase. PMID: 23410839
  49. results provide evidence plasma from preeclampsia generates superoxide via a LOX1-NOX2-mediated pathway and downregulates endothelial KCa3.1, which may contribute to endothelial dysfunction and vasculopathy in preeclampsia PMID: 23261940
  50. Nox1 levels were higher in the primary SW480 cells than that in metastatic SW620 cells. PMID: 23627409

Show More

Hide All

Involvement in disease
Defects in NOX1 may play a role in the pathogenesis of very early onset inflammatory bowel disease (VEOIBD), a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology diagnosed before 6 years of age. VEOIBD is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but the phenotype of children with onset of Crohn disease occurring younger than the age of 10 is predominantly colonic, with a lower risk of ileal disease. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
Subcellular Location
Cell projection, invadopodium membrane; Multi-pass membrane protein. Cell membrane.
Tissue Specificity
NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.
Database Links

HGNC: 7889

OMIM: 300225

KEGG: hsa:27035

STRING: 9606.ENSP00000362057

UniGene: Hs.592227

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*