Recombinant Human T-cell surface glycoprotein CD3 zeta chain (CD247)

Code CSB-CF004904HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CD247; CD3Z; T3Z; TCRZ; T-cell surface glycoprotein CD3 zeta chain; T-cell receptor T3 zeta chain; CD antigen CD247
Species
Homo sapiens (Human)
Expression Region
22-164
Target Protein Sequence
QSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Gene References into Functions
  1. Data confirm previous findings that the CD247 polymorphisms are mainly associated with the clinical outcome of systemic lupus erythematosus and less with susceptibility. PMID: 30064597
  2. analysis of the assembly and surface expression of FcepsilonR1alpha in cells shows that CD16A associates equally well with human CD247 and FcepsilonR1gamma homodimers PMID: 28652325
  3. Long-term lung function decline in asthma is associated with elevation of bronchial CD8 and CD4 at baseline, and CD8, CD3 and granzyme B at follow-up PMID: 27230446
  4. Crk-dependent increased phosphorylation of CD3zeta coincided with inhibition of TCR downmodulation, supporting a positive role for Crk adaptor proteins in TCR-mediated signal amplification. PMID: 28465009
  5. the immunohistochemical staining patterns of CD3 and CD20 in Malignant Lymphoma Cells, were investigated. PMID: 28442514
  6. CD274 up-regulation in new-onset type 1 diabetes mellitusis correlated with disease pathogenesis. PMID: 28577136
  7. our observations suggested that CD247 gene polymorphism (rs858554) may associated with the susceptibility of RA. PMID: 27118209
  8. CD3/28-activated T cells expanded in IL-7 and IL-15 produced greater expansion of memory stem T cells and central memory T cell-derived T cells compared with IL-2. Our strategy provides a powerful tool to elucidate the characteristics of CAR-modified T cells, regardless of the protocol used for expansion, reveals the functional properties of each expanded T cell subset. PMID: 28550199
  9. Multiple mutations were found in CD247 complementary DNAs (cDNAs) cloned from the patient as well as in cDNA and genomic DNA from other individuals, suggesting that genetic variation in this gene is frequent. PMID: 28743717
  10. Single-nucleotide polymorphism in CD247 gene is associated with sclerotic graft-versus-host disease. PMID: 27313329
  11. CD3Z hypermethylation was significantly correlated with SLE. CD3Z hypermethylation is an SLE risk factor that can be modified by environmental factors and is associated with more severe SLE clinical manifestations, which are related to deranged T cell function by downregulating the CD3zeta-chain. PMID: 27940592
  12. Linkage and association studies revealed a chromosomal region in which a novel type 1 diabetes (T1D)/autoimmune thyroid disease (AITD) susceptibility gene, CD247, is located and showed association between T1D/AITD and several variants in this gene. These results suggests that common susceptibility genes act in concert with variants of CD247 to generate genetic risk for T1D/AITD in this population. PMID: 27716086
  13. SRSF1 regulates CD3zeta expression in human T cells and may contribute to the T cell defect in systemic lupus erythematosus. PMID: 26134847
  14. In localized colorectal cancer carriers, mRNA-based CD3Z/CD8 profiling of tumor immune response may have stage, site and tissue-specific prognostic significance, along with ESR1 expression. PMID: 25970543
  15. identified among the key genes in circulating monocytes that were altered by exercise PMID: 26207425
  16. Our study independently confirms and extends the association of SLE with CD247, which is shared by various autoimmune disorders and supports a common T-cell-mediated mechanism. PMID: 25569266
  17. we observed decreased CD3 surface expression, reduced ZAP-70 abundance and increased histone H3-acetylation in activated T lymphocytes after 5 minutes of clinorotation and a transient downregulation of CD3 and stable downregulation of IL-2R PMID: 25661802
  18. T cell receptor (TCR)-CD3 complex and the Lck kinase were required for Ca(2+) mobilization but not for apoptosis induction in Jurkat cells. PMID: 25947381
  19. These findings confirm the role of PTPN22 and CD28 involved in the T cell activation pathway in the development of T1D in Tunisian families. Interestingly, ZAP70 and TCRbeta/CD3z seem to contribute to the susceptibility to the disease in our population. PMID: 25448703
  20. a CD247 defect leads to the accumulation of naive, hyporesponsive gammadelta and alphabeta T cells in thymoma patient resulting in a novel type of acquired T cell immunodeficiency and immune dysregulation of clinical significance. PMID: 25732729
  21. CD247 downregulation was associated with disease severity, complications, and the occurrence of future cardiovascular events, suggesting its potential use not only as a diagnostic but also as a prognostic biomarker. PMID: 25368105
  22. Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression. PMID: 25513989
  23. Myeloid-derived suppressor cell frequency in peripheral blood is directly correlated with the HCV RNA load in the plasma and inversely correlated with TCR zeta chain expression in CD8(+) T cells. PMID: 24552712
  24. Two transcription factor binding sites and a long non-coding RNA are identified within the Cd247 gene. PMID: 24797614
  25. LAT is a modulator of CD3zeta and ZAP-70 tyrosine phosphorylation. PMID: 24204825
  26. A deficient lipid rafts recruitment of CD3zeta/ZAP-70/Grb2, and these proteins do not merge with GM1 within the lipid rafts. PMID: 23916875
  27. Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk. PMID: 23861880
  28. A review of the possible roles of CD247 gene variants and single-nucleotide polymorphisms in systemic lupus erythematosus pathogenesis. PMID: 23525753
  29. Low expression of T-cell antigen receptor complex zeta is associated with chronic myeloid leukemia. PMID: 23228155
  30. Data indicate that TCRzeta gene transfection could restore TCRzeta chain deficiency and enhance IL-2 production in T cells from patients with chronic myeloid leukemia (CML). PMID: 23057733
  31. It was shown that CD8alpha/CD3zeta rescues pertussis toxin-induced signaling events lacking in TCR null cells, indicating that CD8alpha/CD3zeta can substitute for TCR and supports the hypothesis that pertussis toxin stimulates signaling via receptor cross-linking. PMID: 22551306
  32. These data provide evidence for src-like adaptor protein-dependent regulation of CD3 zeta-chain in the fine control of TCR signaling. PMID: 22798681
  33. The rs12133337 polymorphism in the CD3Z gene might affect the immune response to hepatitis B vaccination, and a lower BMI might increase the contribution of the polymorphism to immunity to hepatitis B vaccination. PMID: 22536368
  34. A novel juvenile idiopathic arthritis susceptibility locus was identified, CD247. PMID: 22294642
  35. peripheral blood lymphocytes (PBLs) of ovarian cancer patients showed lower JAK3, CD3-zeta molecules expression levels, as well as lower STAT3 and CD3-zeta phosphorylation levels than cells of control. PMID: 22221142
  36. The CD3-zeta chimeric antigen receptor overcomes TCR Hypo-responsiveness of human terminal late-stage T cells. PMID: 22292024
  37. Data show a significant association between variants in CD247 and systemic lupus erythematosus in Asian populations. PMID: 22004975
  38. CD247 as an systemic sclerosis susceptibility gene PMID: 21474487
  39. The expression level of CD3zeta in chronic myeloid leukemia patients was lower than in controls. PMID: 20723304
  40. CD247 is a new susceptibility locus for systemic sclerosis PMID: 20383147
  41. ASF/SF2 as a novel factor in the regulation of alternative splicing of the 3'-UTR of CD3zeta and protein expression in human T cells. PMID: 20118245
  42. Blockade of B7-H1 greatly promoted the proliferation of CD3AK cells and extended the survival time of CD3AK cells in vitro. PMID: 19664385
  43. CD3zeta transcripts and protein were found to be absent from most solid tumor-TILs from patients with ovarian cancer, whereas they were expressed in ASC-TILs and PBMCs from such patients. PMID: 20032419
  44. T cells grafted with a recombinant CD3zeta/CD28 signaling receptor secrete high amounts of IL-2 upon antigen binding without exogenous B7/CD28 costimulation, demonstrating that complete T cell activation can be delivered by one chimeric receptor molecule. PMID: 11714771
  45. experimental, computational and evolutionary approaches predicts the presence of a tetrameric form for CD3-zeta PMID: 11851345
  46. Our data indicate that TCR-signaling pathways are differentially affected by physiological levels of oxidative stress PMID: 11916964
  47. reduced expression in tumor-infiltrating lymphocytes strongly correlated with progressive disease in gastric carcinoma PMID: 11920499
  48. Regulation of T cell receptor CD3zeta chain expression by L-arginine. PMID: 11950832
  49. Defective expression and altered tyrosine phosphorylation of TCR zeta was found in a large proportion of SLE patients, suggesting that it may play an important role in T cell dysfunction in SLE. PMID: 12100036
  50. ZAP-70, a tyrosine kinase known to be crucial for T cell activation, as a key player in TCR down-modulation and zeta degradation. PMID: 12165490

Show More

Hide All

Involvement in disease
Immunodeficiency 25 (IMD25)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
CD3Z/FCER1G family
Tissue Specificity
CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs).
Database Links

HGNC: 1677

OMIM: 186780

KEGG: hsa:919

STRING: 9606.ENSP00000354782

UniGene: Hs.156445

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1