Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14)

Code CSB-CF023991HU(A4)
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TNFSF14; HVEML; LIGHT; UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258
Species
Homo sapiens (Human)
Expression Region
1-240
Target Protein Sequence
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production.
Gene References into Functions
  1. the outcomes of this study provide compelling evidence that TNFSF14 is necessary to limit relevant steps in the pathogenesis of the metabolic syndrome and support the development of agonists of TNFSF14 signaling as attractive therapeutics for treating obesity and type 2 diabetes PMID: 29359470
  2. LIGHT is highly expressed and companied with severe inflammations in patients with coronary disease. LIGHT significantly enhanced inflammation response in oxLDL-induced THP-1 macrophages. PMID: 28642135
  3. LIGHT and LTBR interaction increases the survival and proliferation of human bone marrow-derived mesenchymal stem cells, and therefore, LIGHT might play an important role in stem cell therapy. PMID: 27835685
  4. Serum LIGHT levels correlate with disease progression and severity in interstitial pneumonia patients with dermatomyositis. PMID: 26448572
  5. LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580
  6. LIGHT controls TSLP to drive pulmonary fibrosis. PMID: 25680454
  7. The tumor necrosis factor superfamily molecule LIGHT promotes keratinocyte activity and skin fibrosis. PMID: 25789702
  8. proliferation and migration would be enhanced in Tca8113 cells with over-expressed TNFSF14 PMID: 26146063
  9. LIGHT, a TNF superfamily member, is involved in T-cell homeostasis and erosive bone disease associated with rheumatoid arthritis. PMID: 25460501
  10. Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT. PMID: 25087510
  11. regulation by NK cell licensing helps to safeguard against TNFSF14 production in response to healthy tissues. PMID: 25512551
  12. The findings suggest a new molecular determinant of LIGHT-mediated pathogenic changes in human bronchial epithelial cells. PMID: 25251281
  13. TNFSF14 has an effect on the activation of basophils and eosinophils interacting with bronchial epithelial cells PMID: 24782592
  14. Triggering of LIGHT induced production of pro-inflammatory mediators such as interleukin-8 and matrix metalloproteinase-9 while suppressing the phagocytic activity. PMID: 24044961
  15. GG carriers of rs1077667, of the LIGHT gene, with the highest risk for Multiple Sclerosis, had the lowest serum levels. PMID: 23037546
  16. although a limited number of activated T-cells infiltrate the tumor and initiate an immune response, the number of LIGHT + T cells infiltrating the tumor is very low PMID: 23514280
  17. findings show that LIGHT is not inhibited by the soluble RANKL receptor OPG and that LIGHT is a potent osteoclastogenesis factor that activates the Akt, NFkappaB and JNK pathways PMID: 23391709
  18. TNFSF14 was significantly increased in sickle-cell anemia, SCA treated with hydroxycarbamide,& HbSC. It could contribute to endothelial activation & inflammation in SCA. PMID: 22775554
  19. This study showed that expression of the death-triggering ligand LIGHT is increased in ALS spinal cords PMID: 22221541
  20. increased plasma levels in patients with atopic dermatitis PMID: 22519595
  21. INF-gamma can synergistically precede LIGHT-induced apoptotic processes through down-regulation of Bcl-2 expression, but not survivin expression. PMID: 21117871
  22. These data clearly indicate that ZFP91 is a key regulator in LIGHT-induced activation of non-canonical NF-kappaB pathway in LTbetaR signaling. PMID: 20804734
  23. Herpes simplex virus 1 gD interfere HVEM function by competing with its natural ligands and by downregulating HVEM. PMID: 20826693
  24. Increased potential for LIGHT receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286
  25. mediates organ-specific donor T cells activation in GVHD PMID: 19826934
  26. suppresses tumor growth by augmentation of immune response PMID: 19716382
  27. There is over expression of genes related to immune and inflammatory responses, including cytokines such as TNFSF14 in interstitial cystitis PMID: 20096889
  28. When highly expressed, LIGHT is capable of promoting effector T cell proliferation and differentiation even in a regulatory T (Treg) cell-enriched, suppressive intestinal environment. PMID: 20042587
  29. These findings suggested that LIGHT might be involved in the progression of inflammatory bone destruction in rheumatoid arthritis. PMID: 19019090
  30. Effects in transgenic mice indicate that human LIGHT may function as a major regulator of T cell activation, and implicate LIGHT signaling pathways in inflammation focused on mucosal tissues. PMID: 11714797
  31. LIGHT (TNFSF14),5 its membrane-anchored ligand, was also present in atheromatous lesions and highest in regions rich in macrophage-derived foam cells. PMID: 11742858
  32. Role of calcium-signaling pathway in the transcriptional control PMID: 12215452
  33. LIGHT may act as an anti-apoptotic agent against TNFalpha-mediated liver injury by blocking the activation of both caspase-3 and caspase-8. PMID: 12393901
  34. LIGHT, a new member of the TNF superfamily [review] PMID: 12456019
  35. Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117
  36. Soluble LIGHT blocks TR6-Fc costimulated proliferation, lymphokine production, and cytotoxicity of T cells in the presence of T cell receptor ligation. PMID: 12471113
  37. LIGHT-sensitized IFN-gamma-mediated apoptosis of MDA-MB-231 cells is probably through down-regulation of anti-apoptosis Bcl-2 family members; it could be caspase (especially caspase-3)-independent, even though extensive caspase activation was observed. PMID: 12767529
  38. LIGHT signaling is mediated through both death receptor and mitochondria pathways PMID: 15115612
  39. LIGHT-herpesvirus entry mediator mediated signaling as an important immune regulatory mechanism in mucosal inflammatory responses. PMID: 15210782
  40. Mechanisms protecting trophoblast cells from LIGHT-mediated apoptosis were studied. PMID: 15215185
  41. LIGHT expression by human intestinal T cells suggests the possibility that LIGHT may play a key role in regulation of the mucosal immune system. PMID: 15634882
  42. LIGHT protein can be activated on mucosal T cells through a gut-specific CD2-dependent signaling mechanism. PMID: 15634882
  43. Data suggest that LIGHT constitutively expressed in human melanoma cells and microvesicles may contribute to regulate T-cell responses to tumor cells. PMID: 15833878
  44. NF-kappaB signal plays a key role in LIGHT-mediated upregulation of CD86 expression. PMID: 15895390
  45. both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine PMID: 15917993
  46. A transgenic mouse model resembling Crohn's disease (CD) suggests that up-regulation of LIGHT may be an important mediator of CD pathogenesis. PMID: 15944326
  47. LIGHT could serve as a molecular link between lipid metabolism, inflammation, and thrombus formation, which are all features of atherosclerotic plaques. PMID: 16186421
  48. platelet-derived LIGHT is biologically active and can induce an inflammatory response in monocytes and particularly within endothelial cells measured as up-regulation of adhesion molecules and release of chemokines PMID: 16861346
  49. Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497
  50. LIGHT system may regulate early to middle stages of placental development via cell-specific, temporally programmed expression of the ligand and its receptors, and may also assist in preserving placental immune privilege. PMID: 17010447

Show More

Hide All

Subcellular Location
[Tumor necrosis factor ligand superfamily member 14, membrane form]: Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 14, soluble form]: Secreted.; [Isoform 2]: Cytoplasm.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tu
Database Links

HGNC: 11930

OMIM: 604520

KEGG: hsa:8740

STRING: 9606.ENSP00000469049

UniGene: Hs.129708

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1