Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 (CSB-MP842173HU) at 5 μg/ml can bind Biotinylated human TNFSF14, the EC₅₀ is 1.773-3.707 ng/ml.

Target Names

TNFSF14

Uniprot No.

O43557

Alternative Names

TNFSF14; HVEML; LIGHT; UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258

Molecular Characterization

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

74-240aa

Target Protein Sequence

DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Mol. Weight

47.3 kDa

Protein Length

Partial

Tag Info

N-terminal hFc-Avi-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant human TNFSF14 is an active protein expressed from mammalian cells, with an N-terminal hFc-Avi-tag. Its expression region is the DNA fragment encoding the amino acid residues 74-240 of the human TNFSF14 protein. The purity of this TNFSF14 protein is greater than 90% measured by SDS-PAGE. This recombinant TNFSF14 protein migrated to the band with a molecular weight of approximately 45 kDa on the gel. Its endotoxin level is less than 1.0 EU/ug determined by the LAL method. And its bioactivity has been validated in the ELISA. In the functional ELISA, this Biotinylated human TNFSF14 protein binds to the human TNFRSF14, with an EC₅₀ constant of 1.773-3.707 ng/ml. This biotinylated TNFSF14 protein could be used to isolate the TNFSF14 antibodies from the samples for subsequent analyses with high sensitivity. It is in stock now.

TNFSF14, also known as LIGHT, is mainly expressed on activated T cells and NK cells, as well as immature dendritic cells (DC). It is a key component of the communication system that controls the T-cell responses. TNFSF14-TNFRSF14 interactions support the production and longevity of TH2 cells and promote TH2 memory through Akt activation.

Target Background

Function

Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production.

Gene References into Functions

the outcomes of this study provide compelling evidence that TNFSF14 is necessary to limit relevant steps in the pathogenesis of the metabolic syndrome and support the development of agonists of TNFSF14 signaling as attractive therapeutics for treating obesity and type 2 diabetes PMID: 29359470
LIGHT is highly expressed and companied with severe inflammations in patients with coronary disease. LIGHT significantly enhanced inflammation response in oxLDL-induced THP-1 macrophages. PMID: 28642135
LIGHT and LTBR interaction increases the survival and proliferation of human bone marrow-derived mesenchymal stem cells, and therefore, LIGHT might play an important role in stem cell therapy. PMID: 27835685
Serum LIGHT levels correlate with disease progression and severity in interstitial pneumonia patients with dermatomyositis. PMID: 26448572
LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells. PMID: 25501580
LIGHT controls TSLP to drive pulmonary fibrosis. PMID: 25680454
The tumor necrosis factor superfamily molecule LIGHT promotes keratinocyte activity and skin fibrosis. PMID: 25789702
proliferation and migration would be enhanced in Tca8113 cells with over-expressed TNFSF14 PMID: 26146063
LIGHT, a TNF superfamily member, is involved in T-cell homeostasis and erosive bone disease associated with rheumatoid arthritis. PMID: 25460501
Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT. PMID: 25087510
regulation by NK cell licensing helps to safeguard against TNFSF14 production in response to healthy tissues. PMID: 25512551
The findings suggest a new molecular determinant of LIGHT-mediated pathogenic changes in human bronchial epithelial cells. PMID: 25251281
TNFSF14 has an effect on the activation of basophils and eosinophils interacting with bronchial epithelial cells PMID: 24782592
Triggering of LIGHT induced production of pro-inflammatory mediators such as interleukin-8 and matrix metalloproteinase-9 while suppressing the phagocytic activity. PMID: 24044961
GG carriers of rs1077667, of the LIGHT gene, with the highest risk for Multiple Sclerosis, had the lowest serum levels. PMID: 23037546
although a limited number of activated T-cells infiltrate the tumor and initiate an immune response, the number of LIGHT + T cells infiltrating the tumor is very low PMID: 23514280
findings show that LIGHT is not inhibited by the soluble RANKL receptor OPG and that LIGHT is a potent osteoclastogenesis factor that activates the Akt, NFkappaB and JNK pathways PMID: 23391709
TNFSF14 was significantly increased in sickle-cell anemia, SCA treated with hydroxycarbamide,& HbSC. It could contribute to endothelial activation & inflammation in SCA. PMID: 22775554
This study showed that expression of the death-triggering ligand LIGHT is increased in ALS spinal cords PMID: 22221541
increased plasma levels in patients with atopic dermatitis PMID: 22519595
INF-gamma can synergistically precede LIGHT-induced apoptotic processes through down-regulation of Bcl-2 expression, but not survivin expression. PMID: 21117871
These data clearly indicate that ZFP91 is a key regulator in LIGHT-induced activation of non-canonical NF-kappaB pathway in LTbetaR signaling. PMID: 20804734
Herpes simplex virus 1 gD interfere HVEM function by competing with its natural ligands and by downregulating HVEM. PMID: 20826693
Increased potential for LIGHT receptor signaling, coupled with increased bioavailability due to lower decoy receptor-3 (DcR3) avidity, provides a mechanism for polymorphic variants in LIGHT to contribute to the pathogenesis of inflammatory diseases. PMID: 20592286
mediates organ-specific donor T cells activation in GVHD PMID: 19826934
suppresses tumor growth by augmentation of immune response PMID: 19716382
There is over expression of genes related to immune and inflammatory responses, including cytokines such as TNFSF14 in interstitial cystitis PMID: 20096889
When highly expressed, LIGHT is capable of promoting effector T cell proliferation and differentiation even in a regulatory T (Treg) cell-enriched, suppressive intestinal environment. PMID: 20042587
These findings suggested that LIGHT might be involved in the progression of inflammatory bone destruction in rheumatoid arthritis. PMID: 19019090
Effects in transgenic mice indicate that human LIGHT may function as a major regulator of T cell activation, and implicate LIGHT signaling pathways in inflammation focused on mucosal tissues. PMID: 11714797
LIGHT (TNFSF14),5 its membrane-anchored ligand, was also present in atheromatous lesions and highest in regions rich in macrophage-derived foam cells. PMID: 11742858
Role of calcium-signaling pathway in the transcriptional control PMID: 12215452
LIGHT may act as an anti-apoptotic agent against TNFalpha-mediated liver injury by blocking the activation of both caspase-3 and caspase-8. PMID: 12393901
LIGHT, a new member of the TNF superfamily [review] PMID: 12456019
Data show that mRNA encoding LIGHT and its receptors [HVEM, LTbetaR, and TR6 (DcR3)] are present in placentas and cytotrophoblast cells at term. PMID: 12466117
Soluble LIGHT blocks TR6-Fc costimulated proliferation, lymphokine production, and cytotoxicity of T cells in the presence of T cell receptor ligation. PMID: 12471113
LIGHT-sensitized IFN-gamma-mediated apoptosis of MDA-MB-231 cells is probably through down-regulation of anti-apoptosis Bcl-2 family members; it could be caspase (especially caspase-3)-independent, even though extensive caspase activation was observed. PMID: 12767529
LIGHT signaling is mediated through both death receptor and mitochondria pathways PMID: 15115612
LIGHT-herpesvirus entry mediator mediated signaling as an important immune regulatory mechanism in mucosal inflammatory responses. PMID: 15210782
Mechanisms protecting trophoblast cells from LIGHT-mediated apoptosis were studied. PMID: 15215185
LIGHT expression by human intestinal T cells suggests the possibility that LIGHT may play a key role in regulation of the mucosal immune system. PMID: 15634882
LIGHT protein can be activated on mucosal T cells through a gut-specific CD2-dependent signaling mechanism. PMID: 15634882
Data suggest that LIGHT constitutively expressed in human melanoma cells and microvesicles may contribute to regulate T-cell responses to tumor cells. PMID: 15833878
NF-kappaB signal plays a key role in LIGHT-mediated upregulation of CD86 expression. PMID: 15895390
both LTbetaR and HVEM can discriminatively mediate the expression of different genes in cultured human umbilical vein endothelial cells, including LIGHT, a proinflammatory cytokine PMID: 15917993
A transgenic mouse model resembling Crohn's disease (CD) suggests that up-regulation of LIGHT may be an important mediator of CD pathogenesis. PMID: 15944326
LIGHT could serve as a molecular link between lipid metabolism, inflammation, and thrombus formation, which are all features of atherosclerotic plaques. PMID: 16186421
platelet-derived LIGHT is biologically active and can induce an inflammatory response in monocytes and particularly within endothelial cells measured as up-regulation of adhesion molecules and release of chemokines PMID: 16861346
Blockade of TNFSF14 signaling caused a substantial reduction in the expression of lymphotoxin beta receptor (LTbetaR)-controlled migration factors within the islets and disrupts organization of tertiary structures, leading to prevention of diabetes. PMID: 16934497
LIGHT system may regulate early to middle stages of placental development via cell-specific, temporally programmed expression of the ligand and its receptors, and may also assist in preserving placental immune privilege. PMID: 17010447

Hide All

Subcellular Location

[Tumor necrosis factor ligand superfamily member 14, membrane form]: Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 14, soluble form]: Secreted.; [Isoform 2]: Cytoplasm.

Protein Families

Tumor necrosis factor family

Tissue Specificity

Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tu

Database Links

HGNC: 11930

OMIM: 604520

KEGG: hsa:8740

STRING: 9606.ENSP00000469049

UniGene: Hs.129708

Code	CSB-MP023991HUj7-B
Abbreviation	Recombinant Human TNFSF14 protein, partial, Biotinylated (Active)
MSDS	MSDS Datasheet
Size	$336
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 (CSB-MP842173HU) at 5 μg/ml can bind Biotinylated human TNFSF14, the EC₅₀ is 1.773-3.707 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tumor necrosis factor ligand superfamily member 14 (TNFSF14), partial,Biotinylated (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage