Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF14 (CSB-MP842173HU) at 5 μg/ml can bind Biotinylated human TNFSF14, the EC50 is 1.773-3.707 ng/ml.
Alternative Names
TNFSF14; HVEML; LIGHT; UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
74-240aa
Target Protein Sequence
DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Tag Info
N-terminal hFc-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human TNFSF14 is an active protein expressed from mammalian cells, with an N-terminal hFc-Avi-tag. Its expression region is the DNA fragment encoding the amino acid residues 74-240 of the human TNFSF14 protein. The purity of this TNFSF14 protein is greater than 90% measured by SDS-PAGE. This recombinant TNFSF14 protein migrated to the band with a molecular weight of approximately 45 kDa on the gel. Its endotoxin level is less than 1.0 EU/ug determined by the LAL method. And its bioactivity has been validated in the ELISA. In the functional ELISA, this Biotinylated human TNFSF14 protein binds to the human TNFRSF14, with an EC50 constant of 1.773-3.707 ng/ml. This biotinylated TNFSF14 protein could be used to isolate the TNFSF14 antibodies from the samples for subsequent analyses with high sensitivity. It is in stock now.
TNFSF14, also known as LIGHT, is mainly expressed on activated T cells and NK cells, as well as immature dendritic cells (DC). It is a key component of the communication system that controls the T-cell responses. TNFSF14-TNFRSF14 interactions support the production and longevity of TH2 cells and promote TH2 memory through Akt activation.