Recombinant Human Tumor necrosis factor receptor superfamily member 13B(TNFRSF13B)

Code CSB-CF023971HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O14836
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
Source in vitro E.coli expression system
Gene Names TNFRSF13B
Protein Names Recommended name: Tumor necrosis factor receptor superfamily member 13B Alternative name(s): Transmembrane activator and CAML interactor CD_antigen= CD267
Expression Region 1-293
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.
Involvement in disease Immunodeficiency, common variable, 2 (CVID2); Immunoglobulin A deficiency 2 (IGAD2)
Subcellular Location Membrane, Single-pass type III membrane protein
Tissue Specificity Highly expressed in spleen, thymus, small intestine and peripheral blood leukocytes. Expressed in resting B-cells and activated T-cells, but not in resting T-cells.
Database Links

HGNC: 18153

OMIM: 240500

KEGG: hsa:23495

STRING: 9606.ENSP00000261652

UniGene: Hs.158341

Related Products

TNFRSF13B Antibodies

TNFRSF13B Antibodies for Homo sapiens (Human)

TNFRSF13B Antibodies for Human

TNFRSF13B Proteins

TNFRSF13B Proteins for Homo sapiens (Human)

TNFRSF13B ELISA Kit

TNFRSF13B ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.