Recombinant Human Vasoactive intestinal polypeptide receptor 2 (VIPR2)

Code CSB-CF025860HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
VIPR2; VIP2R; Vasoactive intestinal polypeptide receptor 2; VIP-R-2; Helodermin-preferring VIP receptor; Pituitary adenylate cyclase-activating polypeptide type III receptor; PACAP type III receptor; PACAP-R-3; PACAP-R3; VPAC2
Species
Homo sapiens (Human)
Expression Region
24-438
Target Protein Sequence
ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTVPCPKVFSNFY SKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLAT GSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCK LSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAAR LYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQY KRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQ CELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
Gene References into Functions
  1. a novel gene duplication syndrome (10q21.2q21.3 microduplication) and new evidence for VIPR2 duplication, as a candidate gene for autism, are reported. PMID: 27796743
  2. Data suggest that VIPR2, which is a negative regulator of smooth muscle cell proliferation, might be a novel tumor suppressor gene in uterine leiomyosarcomas. PMID: 29063609
  3. The 'CC' genotype of the VIPR2 gene was nominally associated with an increased risk of SCZ in male Han Chinese patients. PMID: 27156032
  4. Lower CpG methylation of VIPR2 in the saliva of children with ADHD. PMID: 26304033
  5. CD4+ T cells in HIV infection show increased levels of expression of VPAC2 PMID: 24469917
  6. This study suggest that carriers of microduplication genotypes of VIPR2 are predisposed to SCZ in Han Chinese. PMID: 24794882
  7. Monocytes from Sjogren's syndrome patients display increased vasoactive intestinal peptide receptor 2 expression and impaired apoptotic cell phagocytosis. PMID: 24827637
  8. Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1. PMID: 23818986
  9. This is the first study to suggest a role of VIPR2 in the genetic susceptibility to high myopia. EGR1, JUN, FOS and VIP are unlikely to be important in predisposing humans to high myopia. PMID: 23637909
  10. Genetic testing for VIPR2-LCR-associated inversions should be performed on available cohorts of psychiatric patients to evaluate their potential pathogenic role PMID: 23073313
  11. Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans. PMID: 22961270
  12. PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats. PMID: 22886412
  13. gene expression level and cAMP signaling of VIPR2 were increased in patients carrying 7q36.3 microduplications, thus implicating VIPR2 in the etiology of schizophrenia.[review] PMID: 21721910
  14. VPAC(2) receptor presents an extranuclear localization and its protein expression is lower than that of VPAC(1) receptor in human breast tissue samples PMID: 20691743
  15. VPAC2 and/or PAC1 receptor activation is involved in cutaneous active vasodilation in humans. PMID: 20395540
  16. Detection of beta-galactosidase marker for human VPAC2/VIPR2 in cells withinin the suprachiasmatic nucleus (SCN) of transgenic mice indicates that VPAC2 may contribute to autoregulation and/or coupling within the SCN core and to control of the SCN shell. PMID: 15090046
  17. analysis of a mutant form of VPAC2 shows its role in signaling and ligand binding PMID: 15302876
  18. a novel recombinant agonist for VPAC2 is not active against PAC1 PMID: 16500728
  19. The abnormal expression of VPCAP2-R mRNA in gallbladder tissue may play a role in the formation of gallbladder stones and gallbladder polyps PMID: 16552823
  20. VPAC2-R mRNA was visualized only in the cerebellum of 7-22-year-old subjects. PMID: 16572459
  21. splice variants may modify the immunoregulatory contributions of the VIP-VPAC2 axis PMID: 16888203
  22. identification and characterization of novel five-transmembrane(5TM) isoforms of VPAC2 PMID: 16934434
  23. altered expression of VPAC2 in activated CD4+ T cells derived from multiple sclerosis (MS) patients rendered CD4+ T cells less responsive to VIP and skewed the system to a predominantly T(h)1 direction. PMID: 17077178
  24. Daily stimulation of VPAC2, but not VPAC1 or PAC1, resulted in up to 90% inhibition of X4 or R5 productive infections in either cell lines or PBMCs. PMID: 17257640
  25. a novel mechanism of calmodulin in regulating PACAP signaling by possible interaction with the inactive state of PAC1 and VPAC2 receptors. PMID: 19269029

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Expressed in CD4+ T-cells, but not in CD8+ T-cells. Expressed in the T-cell lines Jurkat, Peer, MOLT-4, HSB, YT and SUP-T1, but not in the T-cell lines HARRIS and HuT 78.
Database Links

HGNC: 12695

OMIM: 601970

KEGG: hsa:7434

STRING: 9606.ENSP00000262178

UniGene: Hs.585052

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1