Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3(NCR3)

Code CSB-CF015551MOV
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
NCR3
Uniprot No.
Alternative Names
NCR3; Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein; NK-p30; NKp30; CD antigen CD337
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
19-176
Target Protein Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGTVLLLRAGFYAVSFLSVAVGSTLYYQGKCHCHMGTHCHS
Protein Length
Full Length of Mature Protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs