Home
Active Protein
Other
Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)

Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)

^{In Stock}

Code	CSB-MP015551MOV1
Abbreviation	Recombinant Cynomolgus monkey NCR3 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3 at 2 μg/ml on an Nickel Coated plate can bind Macaca fascicularis NCR3LG1(CSB-MP4942MOVd9). The EC₅₀ is 7.429 to 11.19 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3 at 2 μg/mL on an Nickel Coated plate can bind Macaca fascicularis NCR3LG1(CSB-MP4942MOVd9). The EC50 is 7.429 to 11.19 ng/mL.

Target Names

NCR3

Uniprot No.

P61483

Alternative Names

Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein (NK-p30;NKp30); CD337; NCR3

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

19-135aa

Target Protein Sequence

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG

Mol. Weight

14.5 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Natural cytotoxicity receptor (NCR) family

Database Links

KEGG: mcf:102133932

UniGene: Mfa.6651

Promotions