Recombinant Mouse BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (Bnip3)

In Stock
Code CSB-CF002766MO
Abbreviation Recombinant Mouse Bnip3 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Bnip3; Nip3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-187aa
Target Protein Sequence
MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant MouseBnip3 protein is an in vitro E.coli (cell-free) expressed Full Length protein. Its purity is 85%+ determined by SDS-PAGE. Cell-free protein expression is the in vitro synthesis of a protein using translation-compatible extracts of whole cells. In principle, whole-cell extracts contain all the macromolecules and components needed for transcription, translation, and even post-translational modification. These components include RNA polymerase, regulatory protein factors, transcription factors, ribosomes, and tRNA. When supplemented with cofactors, nucleotides, and the specific gene template, these extracts can synthesize proteins of interest in a few hours.

Bnip3, a pro-apoptotic BH3-only protein of the Bcl-2 family, is involved in apoptosis, programmed necrosis, autophagy, and mitophagy in the process of cells and tissues exposed to hypoxia or ischemia. In addition to involvement in cell death and metastasis-associated processes, Bnip3 can also regulate different metabolic pathways, such as lipid metabolism, glycolysis, and mitochondrial bioenergetics. Bnip3 also plays a critical role in carcinogenesis. Upregulated expression of Bnip3 has been reported in lung, prostate, cervical tumors, and breast cancers. Increased Bnip3 expression has been linked to the aggressive tumor phenotype and a dismal prognosis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway.
Gene References into Functions
  1. High-fat-mediated liver damage is associated with Sirt3 downregulation, which is followed by ERK-CREB pathway inactivation and Bnip3-mediated inhibition of mitophagy, causing hepatocytes to undergo mitochondria-dependent cell death. PMID: 30056271
  2. JNK activates Mff and Bnip3, contributing to the fatal mitochondrial fission and mitophagy, respectively. PMID: 29149759
  3. BNIP3 expression was upregulated in hypoxic keratinocytes, and BNIP3 silencing suppressed hypoxia-induced cell migration. PMID: 27783443
  4. In a neuronal model of dominant optic atrophy, BNIP3 down-regulation reduced autophagy and mitophagy. PMID: 27861891
  5. Down-regulation of Bcl2/adenovirus E1B 19-kDa-interacting protein 3 (BNIP3) by olomoucine, a cyclin-dependent kinasesinhibitor, reduces lipopolysaccharide - and nitric oxide-induced cell death in BV2 microglial cells. Olomoucine may protect cells by limiting proinflammatory responses, thereby reducing nitric oxide generation. PMID: 27345388
  6. data outline Bnip3 as a key effector of PPARgamma-mediated adipose mitochondrial network fragmentation, improving insulin sensitivity and limiting oxidative stress. PMID: 27325287
  7. the results suggest that BNIP3 plays a vital role in regulating PINK1 mitochondrial outer membrane localization, the proteolytic process of PINK1 and PINK1/parkin-mediated mitophagy under physiological conditions. PMID: 27528605
  8. BNIP3 interacts with the mitochondrial outer membrane directly via mitochondrial BAX. PMID: 28333095
  9. Data show that TGFbeta-activated kinase-1 (TAK1) activated nuclear factor of activated T-cells (NFAT)/NF-kappa B (NFkappaB), downregulated BCL2-adenovirus E1B interacting protein 3 (Bnip3), and inhibited cardiac cell death. PMID: 26564789
  10. propose that BNIP3 acts as a brake on HIF-1 activity serving to increase rates of mitophagy in response to hypoxia and to limit production of damaging ROS that would further amplify HIF-1 expression and promote tumor progression to metastasis PMID: 26232272
  11. Results suggest that Bnip3 regulates cardiac gene expression and perhaps myocyte morphology by activating nuclear p300 acetyltransferase and hyperacetylating histones and its selective transcription factors. PMID: 26317696
  12. Bnip3 dual-functionality and crosstalk between mitophagy and apoptosis pathways is presented here. PMID: 26253153
  13. regulates mitophagy during hypoxia, whereas NIX is required for mitophagy during development of the erythroid lineage. PMID: 25753537
  14. role in the generation of robust NK cell memory in the process of mitophagy during viral infection PMID: 26253785
  15. BNIP3 primarily regulates basal level of mitophagy in physiological conditions, whereas BNIP3 exclusively activates excessive mitophagy leading to cell death. PMID: 25230377
  16. Bnip3 generation, mediated by PARP1, causes mitochondrial damage and neuron death. PMID: 25429139
  17. Suggest pro-tumorigenic role of BNIP3 driving melanoma cell's aggressive features, like migration and vasculogenic mimicry. PMID: 24625986
  18. BNIP3 has a protective effect against UVB-induced apoptosis in keratinocytes PMID: 24402046
  19. The BNIP3 cell death pathway may be a new target for protecting oligodendrocytes from death after stroke PMID: 23692407
  20. Bnip3 is a required downstream effector of FoxO-driven autophagic flux in mechanically unloaded failing myocardium. PMID: 23568341
  21. These results uncover a mechanism of cavitation through hypoxia-induced apoptosis of the core cells mediated by HIFs, Bnip3, and AIF. PMID: 22753893
  22. Loss of BNip3 resulted in increased lipid synthesis in the liver that was associated with elevated ATP levels, reduced AMP-regulated kinase (AMPK) activity, and increased expression of lipogenic enzymes. PMID: 22547685
  23. our mouse model demonstrates a balance between BNIP3-mediated autophagy and H-ras(val12)-induced tumor formation and reveals that H-ras(val12) induces autophagy in a BNIP3-dependent manner. PMID: 22241963
  24. The role of HIF-1alpha or NBIP3 in hypoxia-induced authophagy activation and osteoclastogenesis is reported. PMID: 21465467
  25. Expression of NOV and BNIP3 in leukemia AML-M(4) is significantly higher than that in normal controls. PMID: 21518474
  26. Suggest that induction of mitochondrial autophagy in response to Bnip3 is a protective response activated by the cardiac myocytes that involves Drp1-mediated mitochondrial fission and recruitment of Parkin. PMID: 21890690
  27. enforced and endogenous expression of Ras coincided with the up-regulation of BNIP3 across a wide spectrum of cancer cells, providing the first experimental evidence that BNIP3 is a regulatory target of H-Ras PMID: 21868531
  28. Bnip3 caused an increase in mitochondrial protease activity, suggesting that Bnip3 might promote degradation of proteins in the mitochondria. PMID: 21278801
  29. findings reveal a novel intrinsic defense mechanism that opposes the mitochondrial defects and cell death of ventricular myocytes that is obligatorily linked and mutually dependent on alternative splicing of Bnip3FL during hypoxia or ischemic stress PMID: 21415393
  30. Expression of MAFbx and Bnip3 was increased in hearts of mice in bearing colonic tumors. PMID: 21167183
  31. Bnip3 mediates mitochondrial permeabilization by a novel mechanism that is different from other BH3-only proteins PMID: 20025887
  32. Bnip3 is important in the cardiomyocyte death pathway after severe hypoxia. PMID: 20160671
  33. The expression of PLAGL2 leads to the mRNA expression of a proapoptotic factor, Nip3 PMID: 11832486
  34. Promoter analysis showed that the region between -281 and -1 of the 5'-upstream enhancer region of murine BNIP3 was sufficient for nitric oxide-dependent expression of BNIP3 PMID: 15358175
  35. Data suggest that Bnip3-mediated upregulation of autophagic activity constitutes a protective response against Bnip3 death signaling. PMID: 16874059
  36. Results identify BNIP3 as a key regulator of hypoxia-induced autophagy and suggest a novel role for the RB tumor suppressor in preventing nonapoptotic cell death by limiting the extent of BNIP3 induction in cells. PMID: 17576813
  37. Bnip3/Bnip3L play a crucial role in anthrax lethal toxin-induced cytotoxicity, and down-regulation of Bnip3/Bnip3L is a mechanism of spontaneous or toxin-induced resistance of macrophages. PMID: 17623653
  38. The study suggests that Bnip3 may actually allow cell survival either by preventing ATP depletion or by eliminating damaged mitochondria. PMID: 17786027
  39. Bnip3 minimizes ventricular remodeling in the mouse. PMID: 17909626
  40. These results suggest that BNIP-3 is a candidate for an intrinsic factor related to antidepressive effects and that Wakan-yaku theory may be useful for the identification of other intrinsic functional molecules. PMID: 18606473
  41. Hepatic BNIP3 was also upregulated in two different models of liver stress in vivo, suggesting that a multitude of inflammatory stresses can lead to the modulation of BNIP3 PMID: 19147804
  42. chronic intermittent hypoxia could up-regulate the expression of Nip3, and result in neuron apoptosis and ultrastructural changes in neurons of the frontal cortex PMID: 19187620
  43. Increased cell injury and/or death could be caused directly by the upregulation of bNip3, a preapoptotic molecule that dimerizes with Bcl-2, or indirectly by the aberrant expression of SP-C-induced endoplasmic reticulum stress in epithelial cells. PMID: 19574421
  44. BNIP3 is an important regulator of caspase-independent neural precursor cell death after hypoxia. PMID: 19915483

Show More

Hide All

Subcellular Location
Mitochondrion. Mitochondrion outer membrane; Single-pass membrane protein.
Protein Families
NIP3 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*