Recombinant Mouse C-C chemokine receptor type 1 (Ccr1)-VLPs

Code CSB-MP004839MO
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(C-C CKR-1)(CC-CKR-1)(CCR-1)(CCR1)(Macrophage inflammatory protein 1-alpha receptor)(MIP-1alpha-R)(RANTES-R)(CD antigen CD191)
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-355aa
Target Protein Sequence
MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLMQHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTHRTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRLIFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPIIYVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for a C-C type chemokine. Binds to MIP-1-alpha, RANTES, and less efficiently, to MIP-1-beta or MCP-1 and subsequently transduces a signal by increasing the intracellular calcium ions level. Responsible for affecting stem cell proliferation.
Gene References into Functions
  1. CCL9 secreted by splenic macrophages induces a CCR1dependent accumulation of MDSCs. PMID: 30365155
  2. The enhanced presence of CCL3 can explain the immediate analgesic effects, independent from an anti-inflammatory action, evoked by the administration of the CCR1 antagonist J113863 in carrageenan- and complete Freund's adjuvant inflamed mice. PMID: 26663750
  3. Inhibition of CCR1, the distal part of this signaling relay, may have a therapeutic impact in metastatic disease with lower toxicity than blocking upstream targets. PMID: 26122939
  4. Data indicate that deletion or inhibition of CC chemokine receptor 1 (CCR1) decreases pain responses. PMID: 25170619
  5. CCR1-mediated accumulation of myeloid cells in the liver microenvironment promotes mouse colon cancer metastasis. PMID: 25326065
  6. CCR1 is required for recruitment of neutrophils during respiratory infection with modified vaccinia virus Ankara. PMID: 25008920
  7. This study demonstrates a Tpl2-dependent mechanism for macrophage expression of select chemokine receptors. PMID: 24713702
  8. Ccr1 plays a critical role in the recruitment of T and mononuclear phagocyte cells to inflamed kidneys of NZB/W mice, which in turn contribute to the progression of renal injury. PMID: 24367031
  9. CCR1.beta-arrestin-2 complex may be related to a potential scavenging function of the receptor, which may be important for maintenance of chemokine gradients and receptor responsiveness in complex fields of chemokines during inflammation. PMID: 24056371
  10. CCR1 expression by both hematopoietic and nonhematopoietic cells favors tumor aggressiveness and liver cancer metastasis development. PMID: 23730212
  11. findings show that CCR1 is pivotal for bone remodeling induced by mechanical loading during orthodontic tooth movement and these actions depend, at least in part, on CCL3 PMID: 23059626
  12. neutrophil Ccr1 amplifies late renal immunopathology and increases mortality in invasive candidiasis by mediating excessive recruitment of neutrophils from the blood to the target organ. PMID: 22916017
  13. a bis-quinoline compound, (7-chloro-N-(4-(7-chloroquinolin-4-ylamino)butyl)quinolin-4-amine; RE-660) has C-C chemokine receptor type 1 (CCR1)-agonistic properties PMID: 22104149
  14. CCR1 functions within the glioblastoma microenvironment through CCR1 and CCR5 in a redundant manner. PMID: 22425022
  15. The selective interaction of CCL3 with its receptor, CCR1, is critical for radiation-induced lung inflammation and fibrosis, and these conditions can be largely prevented by a small molecule inhibitor of CCR1 PMID: 20870892
  16. chemokine receptors CCR1, CCR2 and CCR4 have roles in the pathogenesis of experimental dengue infection in mice PMID: 21206747
  17. Data suggest that the CCR1 receptor has a key role in the pathogenesis of smoke-induced inflammation. PMID: 20387089
  18. These results suggest that peripheral nerve injury elicits the up-regulation of spinal MIP-1alpha and CCR1 to participate in neuropathic pain. PMID: 20692319
  19. the axis of CCR1 and its ligands are likely to be involved in cross-talk between osteoclasts and osteoblasts by modulating the RANK-RANKL-mediated interaction. PMID: 20571024
  20. Lack of the Ccr1, Mmp2, or Mmp9 gene in the host dramatically suppresses outgrowths of disseminated tumors in the liver. PMID: 20616008
  21. Overexpression of CCR1 enhances transplanted mesenchymal stem cell survival, migration, and engraftment in ischemic myocardium. PMID: 20378860
  22. Mast cells produce intercellular connections and that mediators are directionally released upon co-stimulation of FcepsilonRI and CCR1. PMID: 20173038
  23. Results reveal the potential involvement of CCL9 and CCR1 in macrophage and microglial cells by CpG-ODNs and may help understanding the role of the chemokine/chemokine receptor pairs in macrophage/microglia under physiologic and pathologic conditions. PMID: 19883904
  24. CCL9 and its receptor CCR1 are the major chemokine and receptor species expressed by osteoclasts PMID: 12397598
  25. CCR1 exacerbates L. major infection in C57BL/6 mice by up-regulating Th2-like response rather than inhibiting Th1 development or/and influencing leucocyte chemotaxis PMID: 12631234
  26. Signaling via CCR1 is critical in the pathogenesis of the IL-13-induced inflammatory pulmonary phenotype. PMID: 14734772
  27. CCR1 plays a significant role in the development of chronic heart graft rejection. PMID: 14757698
  28. Ccr1 is essential for establishment of an efficient antiviral response during a systemic HSV-2 infection. PMID: 15030585
  29. CCR1 has a role in progression of experimental lupus nephritis PMID: 15153561
  30. CCR1 chemokines may stimulate the chemotactic recruitment and RANKL formation of bone-resorptive osteoclasts and have a role in skeletal diseases PMID: 15537451
  31. While dispensable for leukocyte recruitment during sepsis, CCR1 is a pivotal focus of host immune response to sepsis that triggers unregulated expression of proinflammatory cytokines resulting in increased injury and mortality. PMID: 15557190
  32. CCR1-mediated recruitment and local activation of macrophages contribute to disease progression in COL4A3-deficient mice. CCR1 is potential therapeutic target for Alport disease or other progressive nephropathies with interstitial macrophage infiltrates. PMID: 15716328
  33. Neutrophil migration observed in this model of immune inflammation is mediated by MIP-1alpha[CCL3], which via CCR1, induces the sequential release of TNF-alpha and LTB(4). PMID: 15831559
  34. Rac activation is critical for both CCR1- and CCR5-triggered signaling cascades mediating beta-chemokine-induced reorganization of the actin cytoskeleton PMID: 15882964
  35. Chemokine receptor CCR1 has functions for leukocyte adhesion to vascular endothelium and for transendothelial diapedesis. CCR1 blockade can improve injury in progressive kidney disease models, even in advanced disease states. PMID: 16088077
  36. observations suggest the contribution of the CCR1-CCL3 axis to hepatocellular carcinoma progression PMID: 16284949
  37. CCR1 signaling cascade is under the control of NFAT2 and seems to enhance the migration of differentiating osteoclasts PMID: 16355273
  38. CCR1 may be a potential target during detrimental pulmonary responses during infection PMID: 16456018
  39. proinflammatory interferon gamma was increased in the neointima of CCR1(-/-) mice, and its blockade unmasked a reduction in macrophage recruitment PMID: 16467202
  40. Alters the immuno-inflammatory response in atherosclerosis and prevents excessive plaque growth and inflammation. PMID: 16491201
  41. analysis of CCR1 chemokine receptor structure and BX 471 antagonist binding followed by experimental validation PMID: 16837468
  42. CCR1 plays a role in osteolysis and angiogenesis in multiple myeloma. It affects myeloma cells and stromal cells. PMID: 17086356
  43. Lack of CCR1 prevents accumulation of CD34(+) iMCs at the invasion front and suppresses tumor invasion. PMID: 17369830
  44. Substance P stimulates expression of neutrophil CCR1 via neurokinin-1 receptor and nuclear factor kappa B activation. PMID: 17494633
  45. CCR1/CCL5 receptor-ligand interactions modulate allo-specific T-cell responses. PMID: 17641205
  46. Ccr1 deficiency reduces inflammatory remodelling and preserves left ventricular function after myocardial infarction. PMID: 18088392
  47. No increase in mortality was observed during the acute phase of disease following MHV infection of mice lacking CCR1 (CCR1-/-) as compared to wild-type (CCR1+/+) mice. PMID: 18158733
  48. identify CCR1 as a potential target for alleviating T-cell accumulation during exacerbation of asthmatic disease. PMID: 18202190
  49. CCR1 and CCR5 and their ligand CCL3 play a crucial role in the regulation of intratumoral dendritic cell accumulation and the subsequent establishment of tumor immunity following induction of tumor apoptosis by suicide genes. PMID: 18644849
  50. In a model of renal ischemia-reperfusion injury, CCR1 is an important factor promoting infiltration by neutrophils and macrophages; however, this activity does not appear to affect tissue injury. PMID: 19050287

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in the heart, spleen, lung, peritoneal exudate cells and leukocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*